LXL04_006050 | RubberDandelionOmics

Gene overview

LXL04_006050

Reference: OH-1004 Chr: Chr02 Coordinates: 1089976-1092208 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · LXL04_006050|LXL04_006050|OH1004|cDNA

ATGATGAGAGTAGGTAAAGCCGTCGCCACAGTTGCTGCTCATAGGGTATTTCGCTGCGAATCCCTTTCAACCAAAAGTCTAAATACTCCAGCGAACTTGTGCTCTTCTCCTATTTCTGATACCACCATCTCGCCGGAACTTCGAAAGATGCCTTCAGCGGTGGAAGCTAAGATCGCGCCGTCGATGCTATCGTCGGACTTCGCCAATCTGGCATCAGAGGCTGAGCGCATGGTCAGCTTCGGTGCCGATTGGCTTCACAT...

CDS

Download CDS FASTA

924 bp · LXL04_006050|LXL04_006050|OH1004|CDS

ATGATGAGAGTAGGTAAAGCCGTCGCCACAGTTGCTGCTCATAGGGTATTTCGCTGCGAATCCCTTTCAACCAAAAGTCTAAATACTCCAGCGAACTTGTGCTCTTCTCCTATTTCTGATACCACCATCTCGCCGGAACTTCGAAAGATGCCTTCAGCGGTGGAAGCTAAGATCGCGCCGTCGATGCTATCGTCGGACTTCGCCAATCTGGCATCAGAGGCTGAGCGCATGGTCAGCTTCGGTGCCGATTGGCTTCACAT...

Protein

Download Protein FASTA

307 aa · LXL04_006050|LXL04_006050|OH1004|PROTEIN

MMRVGKAVATVAAHRVFRCESLSTKSLNTPANLCSSPISDTTISPELRKMPSAVEAKIAPSMLSSDFANLASEAERMVSFGADWLHMDIMIDVDLQDGYVSDLAKALLLFFPIYQKLADSCHFVQNLTIGAPVIASLRKHTKAYLDCHLMVTNPLDYVDQLSKAGASGFTFHVEVSQDNWQELVTQIKSKGMKPGVALKPGTPIEDVYPLLEGENPVEMVLVMTVEPGFGGQKFIPDMMNKVRTLREKYPELDIEVDGGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006050`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006050

Location Chr02:1089976-1092208 (+)

Description Similar to Os09g0505700: Ribulose-phosphate 3-epimerase, cytoplasmic isoform

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0505700`	Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006050 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006098 pentose-phosphate shunt Biological Process

GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004750 D-ribulose-phosphate 3-epimerase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ago:AGOS_AFL208C

cgr:2890792

dosa:Os09g0505700

sce:YJL121C

spo:2543174

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.541

Rank 1 · LXL04_006050 · OH-1004

Mitochondrion0.439

Rank 2 · LXL04_006050 · OH-1004

Cytoplasm0.081

Rank 3 · LXL04_006050 · OH-1004

Nucleus0.038

Rank 4 · LXL04_006050 · OH-1004

Extracellular0.023

Rank 5 · LXL04_006050 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00834.26Ribul_P_3_epim57-90 aa

PF00834.26Ribul_P_3_epim121-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006050	`PF00834.26`	Ribul_P_3_epim	57	90	8.2e-63	212.1
LXL04_006050	`PF00834.26`	Ribul_P_3_epim	121	283	8.2e-63	212.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SE42`	Oryza sativa subsp. japonica	Ribulose-phosphate 3-epimerase, cytoplasmic isoform	69.758%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card