LXL04_005919 | RubberDandelionOmics

Gene overview

LXL04_005919

Reference: OH-1004 Chr: Chr01 Coordinates: 175714070-175715078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · LXL04_005919|LXL04_005919|OH1004|cDNA

ATGGAACCAACGAATCTTGTGTTTTTCCTCATTGTCTGTTTTCTTCACGATCTCAGCTTAGCTTTCTCCGATCATTCAAATGTACCTATCGGAATCCACCCTCTAGATGAGAAGTACTTTGCGTCGGAGGTCATCAGATGCAAAGATGGATCGAATTCTTTCACTAAAGATCGTATCAACGACGAATTCTGCGACTGCGTTGATGGTACCGATGAACCTGGAACATCAACTAGCCCTGCTGCCAAATTCTATTGCAGGAT...

CDS

Download CDS FASTA

588 bp · LXL04_005919|LXL04_005919|OH1004|CDS

ATGGAACCAACGAATCTTGTGTTTTTCCTCATTGTCTGTTTTCTTCACGATCTCAGCTTAGCTTTCTCCGATCATTCAAATGTACCTATCGGAATCCACCCTCTAGATGAGAAGTACTTTGCGTCGGAGGTCATCAGATGCAAAGATGGATCGAATTCTTTCACTAAAGATCGTATCAACGACGAATTCTGCGACTGCGTTGATGGTACCGATGAACCTGGAACATCAACTAGCCCTGCTGCCAAATTCTATTGCAGGAT...

Protein

Download Protein FASTA

195 aa · LXL04_005919|LXL04_005919|OH1004|PROTEIN

MEPTNLVFFLIVCFLHDLSLAFSDHSNVPIGIHPLDEKYFASEVIRCKDGSNSFTKDRINDEFCDCVDGTDEPGTSTSPAAKFYCRISGSTPRFLFSSRVNDQICDCCDGSDEYDGSITCPNTCIMGGHSEYKTINYSSRISKFTSDRTKQNKVNLNGEDTIQKLQGNINTFHFILLVNHSLKLVNLSWPICFFI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005919`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005919

Location Chr01:175714070-175715078 (+)

Description Similar to PSL4: Glucosidase 2 subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56360`	Regulatory subunit of glucosidase II (By similarity).	Uncoupling of sustained MAMP receptor signaling from early outputs in an Arabidopsis endoplasmic reticulum glucosidase II allele.2009 · DOI: 10.1073/pnas.0907711106

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WNF5`	Regulatory subunit of glucosidase II.	No verified direct reference in this release
`Os01g0276800`	Regulatory subunit of glucosidase II.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005919 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006491 N-glycan processing Biological Process

GO:0006952 defense response Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071941 nitrogen cycle metabolic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0017177 glucosidase II complex Cellular Component

GO:0043231 intracellular membrane-bounded organelle Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G56360

dosa:Os01g0276800

hsa:5589

mmu:19089

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.278

Rank 1 · LXL04_005919 · OH-1004

Cell membrane0.211

Rank 2 · LXL04_005919 · OH-1004

Lysosome / Vacuole0.197

Rank 3 · LXL04_005919 · OH-1004

Cytoplasm0.188

Rank 4 · LXL04_005919 · OH-1004

Golgi apparatus0.147

Rank 5 · LXL04_005919 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12999.13PRKCSH-like54-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005919	`PF12999.13`	PRKCSH-like	54	135	1.3e-24	87.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM96`	Arabidopsis thaliana	Glucosidase 2 subunit beta	64.706%	Swiss-Prot	moderate database homology
`A2WNF5`	Oryza sativa subsp. indica	Glucosidase 2 subunit beta	49.650%	Swiss-Prot	moderate database homology
`Q5NBP9`	Oryza sativa subsp. japonica	Glucosidase 2 subunit beta	49.650%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card