LXL04_005876 | RubberDandelionOmics

Gene overview

LXL04_005876

Reference: OH-1004 Chr: Chr01 Coordinates: 174904739-174906619 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1881 bp · LXL04_005876|LXL04_005876|OH1004|cDNA

ATGTTGGCTGGGTGTTCTTCAACATTTAGTAACTTCCCTTCAATGAGCACACAAAGATTGGATTTGCCATGTAATACTAATTTCCCGCGTAAAGATTCATCAAGATCGCAGCCAGTTAGACCGGTGGGACCCATTTCCGTCGACAACACCACCATCGAATCAAGAACCAGCAACTGTTCACTTAAGCACACAGTCGTAGAAAAAAAGACCGACATTTGGGATAATAACAACAACGGTAATAATAAAGGGTTAAAAAGACT...

CDS

Download CDS FASTA

1881 bp · LXL04_005876|LXL04_005876|OH1004|CDS

ATGTTGGCTGGGTGTTCTTCAACATTTAGTAACTTCCCTTCAATGAGCACACAAAGATTGGATTTGCCATGTAATACTAATTTCCCGCGTAAAGATTCATCAAGATCGCAGCCAGTTAGACCGGTGGGACCCATTTCCGTCGACAACACCACCATCGAATCAAGAACCAGCAACTGTTCACTTAAGCACACAGTCGTAGAAAAAAAGACCGACATTTGGGATAATAACAACAACGGTAATAATAAAGGGTTAAAAAGACT...

Protein

Download Protein FASTA

626 aa · LXL04_005876|LXL04_005876|OH1004|PROTEIN

MLAGCSSTFSNFPSMSTQRLDLPCNTNFPRKDSSRSQPVRPVGPISVDNTTIESRTSNCSLKHTVVEKKTDIWDNNNNGNNKGLKRLYEDDQDESFRAKRKRGCSKVEEFDENEENFWFSKHQQGFVIDSVNSLPFSPQLRTSPWSFVNELADLGERGVSSSSHRRVVKETSSGSGSRSSSPESNRSLDAGGANGVGVGVGVGAPNPNQSLDLLAIGNTNHDEEVGFELISLLLACLEAIGTKNIPAINHFVSKLGELAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005876`
TK1151 ID	TkA01G010380
OH-1004 ID	LXL04_005876
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005876

Location Chr01:174904739-174906619 (-)

Description Similar to SCL28: Scarecrow-like protein 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63100`	Probable transcription factor involved in plant development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005876 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0007584 response to nutrient Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010247 detection of phosphate ion Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0032875 regulation of DNA endoreduplication Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G63100

mtr:11438339

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.798

Rank 1 · LXL04_005876 · OH-1004

Cytoplasm0.226

Rank 2 · LXL04_005876 · OH-1004

Cell membrane0.049

Rank 3 · LXL04_005876 · OH-1004

Endoplasmic reticulum0.032

Rank 4 · LXL04_005876 · OH-1004

Plastid0.025

Rank 5 · LXL04_005876 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514.21GRAS230-609 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005876	`PF03514.21`	GRAS	230	609	9.7e-114	380.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAN3`	Arabidopsis thaliana	Scarecrow-like protein 28	50.077%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card