LXL04_005848 | RubberDandelionOmics

Gene overview

LXL04_005848

Reference: OH-1004 Chr: Chr01 Coordinates: 174465129-174467016 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · LXL04_005848|LXL04_005848|OH1004|cDNA

ATGGGATTCCTGAGAACAGTTGCAGTATCGTCAACAACGACGGCCGTCACAGCAGCAGCACTCGCCATCAATTCCCTCTCGCcatcttcttcctcttcttaTAATCACAATTTCACAAAACCCTTTTTGAATTCCTCCTCTTCAATCGGAAATCGTTTCGAGCTTACGAAGACTCTCATCAAACCTCCTTCTGCACTTCACATGGACACTAAACCCGCCCCAAAGCACGATGCGGAATTACCGGAAGTTATGACAGAGTT...

CDS

Download CDS FASTA

930 bp · LXL04_005848|LXL04_005848|OH1004|CDS

ATGGGATTCCTGAGAACAGTTGCAGTATCGTCAACAACGACGGCCGTCACAGCAGCAGCACTCGCCATCAATTCCCTCTCGCCATCTTCTTCCTCTTCTTATAATCACAATTTCACAAAACCCTTTTTGAATTCCTCCTCTTCAATCGGAAATCGTTTCGAGCTTACGAAGACTCTCATCAAACCTCCTTCTGCACTTCACATGGACACTAAACCCGCCCCAAAGCACGATGCGGAATTACCGGAAGTTATGACAGAGTT...

Protein

Download Protein FASTA

309 aa · LXL04_005848|LXL04_005848|OH1004|PROTEIN

MGFLRTVAVSSTTTAVTAAALAINSLSPSSSSSYNHNFTKPFLNSSSSIGNRFELTKTLIKPPSALHMDTKPAPKHDAELPEVMTEFMVDMSCEGCAKSVKNKLQTVDGVKTIDVDLPNQVVRIFGSAPVKTMAESLQQTGKKARLIGQGSPGDMLISAAVAEFKGPDVFGVVRLTHVSMELARIEANFSGLSPLKKHGWCINEFGDLTRGVASTGKTFNKALGDLGTLEVDEKGEAFYSGVKNNLKISDLIGRAIAVYG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005848`
TK1151 ID	TkA01G013070
OH-1004 ID	LXL04_005848
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005848

Location Chr01:174465129-174467016 (+)

Description Similar to CCS: Copper chaperone for superoxide dismutase, chloroplastic/cytosolic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12520`	Copper chaperone for the superoxide dismutases CSD1, CSD2 and CSD3.	A copper chaperone for superoxide dismutase that confers three types of copper/zinc superoxide dismutase activity in Arabidopsis.2005 · DOI: 10.1104/pp.105.065284

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0573200`	Copper chaperone for superoxide dismutases (SODs).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005848 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006878 intracellular copper ion homeostasis Biological Process

GO:0019430 removal of superoxide radicals Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0051353 positive regulation of oxidoreductase activity Biological Process

GO:0051604 protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G12520

dosa:Os04g0573200

hsa:9973

mmu:12460

ssc:414913

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.880

Rank 1 · LXL04_005848 · OH-1004

Mitochondrion0.131

Rank 2 · LXL04_005848 · OH-1004

Cytoplasm0.047

Rank 3 · LXL04_005848 · OH-1004

Nucleus0.028

Rank 4 · LXL04_005848 · OH-1004

Cell membrane0.026

Rank 5 · LXL04_005848 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403.33HMA87-143 aa

PF00080.26Sod_Cu170-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005848	`PF00403.33`	HMA	87	143	1.3e-13	51.8
LXL04_005848	`PF00080.26`	Sod_Cu	170	266	2.9e-13	51.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD47`	Arabidopsis thaliana	Copper chaperone for superoxide dismutase, chloroplastic/cytosolic	59.790%	Swiss-Prot	strong database homology
`Q7XTY9`	Oryza sativa subsp. japonica	Copper chaperone for superoxide dismutase, chloroplastic	69.565%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card