LXL04_005817 | RubberDandelionOmics

Gene overview

LXL04_005817

Reference: OH-1004 Chr: Chr01 Coordinates: 173844070-173847042 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · LXL04_005817|LXL04_005817|OH1004|cDNA

ATGCTACCCTACGCCTCCATACACGACGCCGAGACCGCCATCGGCCGATCACTCACCGCCGCCGAAGCCTTCTGGTTCAATTACTCCGCCACCAAATCCGATTACTTCCTCTACTGCCACAATATCCTCTTCCTCTTCCTCGTCTTCTCTCTCGTCCCTCTCTTCTACGTCTCCATCGAGCTCGTGTTCTCCAGATACGTTACGCCTTACAAAATTCAACCTAAAGTTAAGAACTCGTTTCTGGATAATCTCAATTGCTA...

CDS

Download CDS FASTA

885 bp · LXL04_005817|LXL04_005817|OH1004|CDS

ATGCTACCCTACGCCTCCATACACGACGCCGAGACCGCCATCGGCCGATCACTCACCGCCGCCGAAGCCTTCTGGTTCAATTACTCCGCCACCAAATCCGATTACTTCCTCTACTGCCACAATATCCTCTTCCTCTTCCTCGTCTTCTCTCTCGTCCCTCTCTTCTACGTCTCCATCGAGCTCGTGTTCTCCAGATACGTTACGCCTTACAAAATTCAACCTAAAGTTAAGAACTCGTTTCTGGATAATCTCAATTGCTA...

Protein

Download Protein FASTA

294 aa · LXL04_005817|LXL04_005817|OH1004|PROTEIN

MLPYASIHDAETAIGRSLTAAEAFWFNYSATKSDYFLYCHNILFLFLVFSLVPLFYVSIELVFSRYVTPYKIQPKVKNSFLDNLNCYFDVMRMFILVVGPLQLVSYPSIKMIGIRTSLPLPSLMEITSQLFVYFLVEDFTNYWIHRFLHGKWGYEKIHKVHHEYTAPIGYAAPYAHWAEVLILGIPSFLGPAMVPGHMITFWLWIALRQIEAIETHSGYDFPWTLTKFIPFYGGADYHDYHHYVGGQSQSNFASVFTYCD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005817`
TK1151 ID	TkAUNG003990
OH-1004 ID	LXL04_005817
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005817

Location Chr01:173844070-173847042 (-)

Description Similar to SMO1-2: Methylsterol monooxygenase 1-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22756`	Non-heme iron oxygenase involved in sterols biosynthesis by catalyzing the removal of the first methyl group at the C-4 position (By similarity).	Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.2018 · DOI: 10.1111/nph.14965 The SMO1 Family of Sterol 4α-Methyl Oxidases Is Essential for Auxin- and Cytokinin-Regulated Embryogenesis.2019 · DOI: 10.1104/pp.19.00144
`At4g12110`	Non-heme iron oxygenase involved in sterols biosynthesis by catalyzing the removal of the first methyl group at the C-4 position.	Acyl-CoA-Binding Protein ACBP1 Modulates Sterol Synthesis during Embryogenesis.2017 · DOI: 10.1104/pp.17.00412 The SMO1 Family of Sterol 4α-Methyl Oxidases Is Essential for Auxin- and Cytokinin-Regulated Embryogenesis.2019 · DOI: 10.1104/pp.19.00144
`At4g22755`	Non-heme iron oxygenase involved in sterols biosynthesis by catalyzing the removal of the first methyl group at the C-4 position (By similarity).	No verified direct reference in this release
`At1g07420`	Non-heme iron oxygenase involved in sterols biosynthesis by catalyzing the removal of the second methyl group at the C-4 position.	Functional identification of sterol-4alpha-methyl oxidase cDNAs from Arabidopsis thaliana by complementation of a yeast erg25 mutant lacking sterol-4alpha-methyl oxidation.2001 · DOI: 10.1016/s0014-5793(01)03002-2 Sterol Methyl Oxidases Affect Embryo Development via Auxin-Associated Mechanisms.2016 · DOI: 10.1104/pp.15.01814

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0545200`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005817 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0055089 fatty acid homeostasis Biological Process

GO:0055092 sterol homeostasis Biological Process

GO:0080064 4,4-dimethyl-9beta,19-cyclopropylsterol oxidation Biological Process

GO:0080065 4-alpha-methyl-delta7-sterol oxidation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0000254 C-4 methylsterol oxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G07420

ath:AT4G12110

ath:AT4G22755

ath:AT4G22756

dosa:Os10g0545200

osa:4349278

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.886

Rank 1 · LXL04_005817 · OH-1004

Cytoplasm0.060

Rank 2 · LXL04_005817 · OH-1004

Nucleus0.055

Rank 3 · LXL04_005817 · OH-1004

Mitochondrion0.049

Rank 4 · LXL04_005817 · OH-1004

Cell membrane0.046

Rank 5 · LXL04_005817 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04116.20FA_hydroxylase131-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005817	`PF04116.20`	FA_hydroxylase	131	265	7e-28	98.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1EC69`	Arabidopsis thaliana	Methylsterol monooxygenase 1-2	75.779%	Swiss-Prot	strong database homology
`Q8L7W5`	Arabidopsis thaliana	Methylsterol monooxygenase 1-1	72.819%	Swiss-Prot	strong database homology
`F4JLZ6`	Arabidopsis thaliana	Methylsterol monooxygenase 1-3	66.894%	Swiss-Prot	strong database homology
`Q8VWZ8`	Arabidopsis thaliana	Methylsterol monooxygenase 2-2	43.701%	Swiss-Prot	moderate database homology
`Q9AV39`	Oryza sativa subsp. japonica	Very-long-chain aldehyde decarbonylase GL1-10	68.729%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card