Gene Card
Gene overview
cDNA / CDS / Protein Sequences
798 bp · LXL04_005810|LXL04_005810|OH1004|cDNA
ATGGCATTAAGCAGGATCCTCGCCACAAACCTCTTGACAGGGATTTTCCAGTTTTCTTCTCCGTCGACCTTCGTTCGCATCTGCGGCACGCATGGTCCGCTCATCCGTCCTCATCCACCCATCTGCTTTATTTCCCGAACAATCACCTATACTCAAGTCCGATGTGCAGCGGCGTCAGATTCCCCCGGCGGTGGCCGTAAAAAGACTTCCTCACGGATGTCTCAGGTTCATCAACTCCTGAACGAAGCCGAGGAGAGAGC...
798 bp · LXL04_005810|LXL04_005810|OH1004|CDS
ATGGCATTAAGCAGGATCCTCGCCACAAACCTCTTGACAGGGATTTTCCAGTTTTCTTCTCCGTCGACCTTCGTTCGCATCTGCGGCACGCATGGTCCGCTCATCCGTCCTCATCCACCCATCTGCTTTATTTCCCGAACAATCACCTATACTCAAGTCCGATGTGCAGCGGCGTCAGATTCCCCCGGCGGTGGCCGTAAAAAGACTTCCTCACGGATGTCTCAGGTTCATCAACTCCTGAACGAAGCCGAGGAGAGAGC...
Protein
Download Protein FASTA265 aa · LXL04_005810|LXL04_005810|OH1004|PROTEIN
MALSRILATNLLTGIFQFSSPSTFVRICGTHGPLIRPHPPICFISRTITYTQVRCAAASDSPGGGRKKTSSRMSQVHQLLNEAEERAAGHNEPIPKITLDHVSVSFARSGGPGGQNVNKGLLPSQFFQINCILPLHSMPKLLVYKLIFSFPVNTKVDMRFNIKEAYWLSDRVGDKILQMEKNRINKDGELVISSTKTRTQKGNIEDALEKLQEIINAASYVPPPPSQEQVKKINKIAAISEAKRLQGKKVLSQKKALRRS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005810 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005810 |
|---|---|
| Location | Chr01:173815608-173816955 (-) |
| Description | Similar to Mrpl58: Peptidyl-tRNA hydrolase ICT1, mitochondrial |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0032543 mitochondrial translation Biological Process GO:0070126 mitochondrial translational termination Biological Process GO:0072344 rescue of stalled cytosolic ribosome Biological Process GO:7770016 rescue of stalled mitochondrial ribosome Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005762 mitochondrial large ribosomal subunit Cellular Component GO:0005886 plasma membrane Cellular Component GO:0003747 translation release factor activity Molecular Function GO:0004045 peptidyl-tRNA hydrolase activity Molecular Function |
| KEGG gene cross-reference | aml:100466987 bta:515465 hsa:3396 mmu:68572 sasa:100196025 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00472.27RF-196-257 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_005810 | PF00472.27 | RF-1 | 96 | 257 | 2e-11 | 44.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.