LXL04_005751 | RubberDandelionOmics

Gene overview

LXL04_005751

Reference: OH-1004 Chr: Chr01 Coordinates: 172690280-172695342 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1164 bp · LXL04_005751|LXL04_005751|OH1004|cDNA

ATGGCGCCGCCGTTGTGTATATTGGTGACTGGTGGTGCCGGATATATAGGGAGTCACACGGTGTTGCAGCTGTTGTTTGACGGGTATAAGGCGGTGGTGGTTGATAATCTTGATAATTCATCTGAAGTCGCTATTAGTCGAGTTCAAGAACTCGCCGGTGATCGTGCCCATAATTTATCTTTTCACAAGTTGTTGTTGGATGGTTataaggtggtggtggttgaaaAACTTGATAATTCCTCTGAACTTGCTATCAGTCG...

CDS

Download CDS FASTA

1164 bp · LXL04_005751|LXL04_005751|OH1004|CDS

ATGGCGCCGCCGTTGTGTATATTGGTGACTGGTGGTGCCGGATATATAGGGAGTCACACGGTGTTGCAGCTGTTGTTTGACGGGTATAAGGCGGTGGTGGTTGATAATCTTGATAATTCATCTGAAGTCGCTATTAGTCGAGTTCAAGAACTCGCCGGTGATCGTGCCCATAATTTATCTTTTCACAAGTTGTTGTTGGATGGTTATAAGGTGGTGGTGGTTGAAAAACTTGATAATTCCTCTGAACTTGCTATCAGTCG...

Protein

Download Protein FASTA

387 aa · LXL04_005751|LXL04_005751|OH1004|PROTEIN

MAPPLCILVTGGAGYIGSHTVLQLLFDGYKAVVVDNLDNSSEVAISRVQELAGDRAHNLSFHKLLLDGYKVVVVEKLDNSSELAISRVQELVGDRAHNLSFHKMDIRDKPALEQLFASTKFDVVIHLAGLKAVGESVKKPLMYYNNNIIGTITLLEVMASYGCKKLVFSSSATVYGVPKEVPCTEEFPLSAVNPYGRTKLMIEEICRDIYTSDPEWKIILLRYFNPIGAHSSGKMGEDPHGTPNNLMPFVQQVAVGRRPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005751`
TK1151 ID	TkA01G019160
OH-1004 ID	LXL04_005751
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005751

Location Chr01:172690280-172695342 (-)

Description Similar to UDP-glucose 4-epimerase GEPI48

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10960`	Catalyzes the interconversion between UDP-glucose and UDP- galactose.	Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200 Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025
`At1g64440`	Catalyzes the interconversion between UDP-glucose and UDP- galactose.	Galactose biosynthesis in Arabidopsis: genetic evidence for substrate channeling from UDP-D-galactose into cell wall polymers.2002 · DOI: 10.1016/s0960-9822(02)01260-5 Growth regulators and the control of nucleotide sugar flux.2004 · DOI: 10.1105/tpc.019661 The reb1-1 mutation of Arabidopsis. Effect on the structure and localization of galactose-containing cell wall polysaccharides.2006 · DOI: 10.1104/pp.105.074997 Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200 UDP-glucose 4-epimerase isoforms UGE2 and UGE4 cooperate in providing UDP-galactose for cell wall biosynthesis and growth of Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049619 Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025
`At4g23920`	Catalyzes the interconversion between UDP-glucose and UDP- galactose.	Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200 UDP-glucose 4-epimerase isoforms UGE2 and UGE4 cooperate in providing UDP-galactose for cell wall biosynthesis and growth of Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049619 Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0595100`	Catalyzes the interconversion between UDP-glucose and UDP-galactose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005751 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005996 monosaccharide metabolic process Biological Process

GO:0006012 galactose metabolic process Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009969 xyloglucan biosynthetic process Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003978 UDP-glucose 4-epimerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G64440

ath:AT4G10960

ath:AT4G23920

dosa:Os05g0595100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.688

Rank 1 · LXL04_005751 · OH-1004

Nucleus0.249

Rank 2 · LXL04_005751 · OH-1004

Mitochondrion0.106

Rank 3 · LXL04_005751 · OH-1004

Peroxisome0.092

Rank 4 · LXL04_005751 · OH-1004

Cell membrane0.066

Rank 5 · LXL04_005751 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370.28Epimerase7-47 aa

PF16363.12GDP_Man_Dehyd8-63 aa

PF07993.19NAD_binding_49-208 aa

PF16363.12GDP_Man_Dehyd62-371 aa

PF01370.28Epimerase62-309 aa

PF02719.22Polysacc_synt_281-229 aa

PF04321.24RmlD_sub_bind96-208 aa

PF01073.263Beta_HSD98-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005751	`PF01370.28`	Epimerase	7	47	4.3e-58	197.3
LXL04_005751	`PF16363.12`	GDP_Man_Dehyd	8	63	1.6e-70	238.9
LXL04_005751	`PF07993.19`	NAD_binding_4	9	208	2.2e-06	27.7
LXL04_005751	`PF16363.12`	GDP_Man_Dehyd	62	371	1.6e-70	238.9
LXL04_005751	`PF01370.28`	Epimerase	62	309	4.3e-58	197.3
LXL04_005751	`PF02719.22`	Polysacc_synt_2	81	229	9.1e-15	55.3
LXL04_005751	`PF04321.24`	RmlD_sub_bind	96	208	2.4e-11	44.0
LXL04_005751	`PF01073.26`	3Beta_HSD	98	205	1.9e-14	54.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SN58`	Arabidopsis thaliana	UDP-glucose 4-epimerase 5	69.211%	Swiss-Prot	strong database homology
`Q9C7W7`	Arabidopsis thaliana	UDP-glucose 4-epimerase 4	68.435%	Swiss-Prot	strong database homology
`Q9T0A7`	Arabidopsis thaliana	UDP-glucose 4-epimerase 2	69.251%	Swiss-Prot	strong database homology
`Q8LNZ3`	Oryza sativa subsp. japonica	UDP-glucose 4-epimerase 1	70.185%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card