LXL04_005692 | RubberDandelionOmics

Gene overview

LXL04_005692

Reference: OH-1004 Chr: Chr01 Coordinates: 170953446-170964829 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4635 bp · LXL04_005692|LXL04_005692|OH1004|cDNA

ATGGGGAGGCCTTATGTCAATAATTCCTTTCGTTCAAGCAAACTATTTATCAATGACAATATTGATGAGATCCTTGCATTCAAAAGAAGTTTGATAGAAAAATCCGGTGACCAGAGTTCATCCAGTCATCGAACCATTTCGTCATCGATTGTTTACTCCTTGCAAAATGAGTTCCTCTCAACGAATACTTTCTATAAAATATCTGCCATTCACGGAAGCTCAGCTATTGTTCTTGGTACAATCAAGGTCATTGAACAAGA...

CDS

Download CDS FASTA

4635 bp · LXL04_005692|LXL04_005692|OH1004|CDS

ATGGGGAGGCCTTATGTCAATAATTCCTTTCGTTCAAGCAAACTATTTATCAATGACAATATTGATGAGATCCTTGCATTCAAAAGAAGTTTGATAGAAAAATCCGGTGACCAGAGTTCATCCAGTCATCGAACCATTTCGTCATCGATTGTTTACTCCTTGCAAAATGAGTTCCTCTCAACGAATACTTTCTATAAAATATCTGCCATTCACGGAAGCTCAGCTATTGTTCTTGGTACAATCAAGGTCATTGAACAAGA...

Protein

Download Protein FASTA

1544 aa · LXL04_005692|LXL04_005692|OH1004|PROTEIN

MGRPYVNNSFRSSKLFINDNIDEILAFKRSLIEKSGDQSSSSHRTISSSIVYSLQNEFLSTNTFYKISAIHGSSAIVLGTIKVIEQEQPWFYIACSNCRRKVQVVKATNDESGDVSQNVESEVFWCSNPMPECQNNVISAAPRFIVRVRVQGVVGVVTLTLFDREVREMLNISAASLVEKYEKAGLENEYPIEFENLLEKKNMHSKLLSITDAVDIISELDMMEKKLTNEHEVESESESVKLSQETVNLKDDTSFTGDNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005692`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_005692`
Location	Chr01:170953446-170964829 (-)
Description	Similar to pif1: ATP-dependent DNA helicase pif1 (Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005692` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0001117 protein-DNA-RNA complex disassembly Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0051276 chromosome organization Biological Process GO:0000781 chromosome, telomeric region Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0031981 nuclear lumen Cellular Component
KEGG gene cross-reference	bba:Bd3546 cje:Cj0945c rno:367645 tbr:Tb11.01.6420 xla:734585 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.926

Rank 1 · LXL04_005692 · OH-1004

Cytoplasm0.138

Rank 2 · LXL04_005692 · OH-1004

Mitochondrion0.037

Rank 3 · LXL04_005692 · OH-1004

Cell membrane0.014

Rank 4 · LXL04_005692 · OH-1004

Extracellular0.009

Rank 5 · LXL04_005692 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08646.17Rep_fac-A_C77-239 aa

PF14214.12Helitron_like_N393-565 aa

PF05970.21PIF11026-1243 aa

PF13604.13AAA_301044-1146 aa

PF21530.4Pif1_2B_dom1345-1389 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005692	`PF08646.17`	Rep_fac-A_C	77	239	4.1e-09	37.1
LXL04_005692	`PF14214.12`	Helitron_like_N	393	565	3.8e-49	168.2
LXL04_005692	`PF05970.21`	PIF1	1026	1243	6e-90	301.4
LXL04_005692	`PF13604.13`	AAA_30	1044	1146	8e-06	26.4
LXL04_005692	`PF21530.4`	Pif1_2B_dom	1345	1389	4.4e-19	68.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card