LXL04_005620 | RubberDandelionOmics

Gene overview

LXL04_005620

Reference: OH-1004 Chr: Chr01 Coordinates: 169415005-169418473 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1509 bp · LXL04_005620|LXL04_005620|OH1004|cDNA

ATGGAAGATCGATGCAACTTTCCTGTAAAGATTGAAACAGGGGACTTTGGTTATGTTCTTGAAGATATTCCTCACCTATCTGATTATGTCCCTAATCTCAAAACATATCCCAATCCAATGCGATTCAATCCTGCATATTCCGTTGTAAAGCAATACTTCATCGATTTTGATGATACTGTGCCAGAAAAGGTTGTCGTCCAAAAAACCGGTCCAAGAGGAGTACATTTTCGCCGGGCTGGGCCCCGCCAAGACGTTTATTT...

CDS

Download CDS FASTA

1509 bp · LXL04_005620|LXL04_005620|OH1004|CDS

ATGGAAGATCGATGCAACTTTCCTGTAAAGATTGAAACAGGGGACTTTGGTTATGTTCTTGAAGATATTCCTCACCTATCTGATTATGTCCCTAATCTCAAAACATATCCCAATCCAATGCGATTCAATCCTGCATATTCCGTTGTAAAGCAATACTTCATCGATTTTGATGATACTGTGCCAGAAAAGGTTGTCGTCCAAAAAACCGGTCCAAGAGGAGTACATTTTCGCCGGGCTGGGCCCCGCCAAGACGTTTATTT...

Protein

Download Protein FASTA

502 aa · LXL04_005620|LXL04_005620|OH1004|PROTEIN

MEDRCNFPVKIETGDFGYVLEDIPHLSDYVPNLKTYPNPMRFNPAYSVVKQYFIDFDDTVPEKVVVQKTGPRGVHFRRAGPRQDVYFRSDEVRACIVTCGGLCPGLNTVIREIVCALHHMYGVTRILGIDGGYRGFYSKNTITLTPKFVNDIHKRGGTVLGSSRGGHDKGKIVDSIQDRGINQVYIIGGDGTQKGAAVIYEEIRRRGIKAVVAGIPKTIDNDISVIDRSFGFDTAVEEAQRAINAAHVEAESAENGIGVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005620`
TK1151 ID	TkA01G028940
OH-1004 ID	LXL04_005620
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005620

Location Chr01:169415005-169418473 (+)

Description Similar to PFK3: ATP-dependent 6-phosphofructokinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26270`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At5g56630`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At4g32840`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At4g29220`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release
`At5g61580`	Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005620 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006002 fructose 6-phosphate metabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003872 6-phosphofructokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G26270

ath:AT4G29220

ath:AT4G32840

ath:AT5G56630

ath:AT5G61580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.669

Rank 1 · LXL04_005620 · OH-1004

Nucleus0.282

Rank 2 · LXL04_005620 · OH-1004

Mitochondrion0.129

Rank 3 · LXL04_005620 · OH-1004

Cell membrane0.073

Rank 4 · LXL04_005620 · OH-1004

Endoplasmic reticulum0.052

Rank 5 · LXL04_005620 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00365.26PFK94-399 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005620	`PF00365.26`	PFK	94	399	2.8e-61	208.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AA4`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 3	78.664%	Swiss-Prot	strong database homology
`Q9C5J7`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 7	76.160%	Swiss-Prot	strong database homology
`Q9M076`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 6	77.042%	Swiss-Prot	strong database homology
`Q9M0F9`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 1	76.404%	Swiss-Prot	strong database homology
`Q9FKG3`	Arabidopsis thaliana	ATP-dependent 6-phosphofructokinase 4, chloroplastic	68.191%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card