LXL04_005524 | RubberDandelionOmics

Gene overview

LXL04_005524

Reference: OH-1004 Chr: Chr01 Coordinates: 166644712-166647367 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

945 bp · LXL04_005524|LXL04_005524|OH1004|cDNA

atgggGCAGCATTCATGTTGCAACCAGCAGAAGGTTAAAAGAGGGCTTTGGTCACCTGAGGAAGATGAAAAGCTCATTAAGTTCATCACAACTCATGGCTACGGCTGCTGGAGTGAAGTCCCAGAGAAAGCTGGGCTTCAAAGATGCGGAAAGAGTTGTCGATTGAGATGGATAAACTATTTGAGACCCGATATCCGAAGAGGAAAGTTTACACCTGAGGAAGAAAAGTTGATCATCAATCTTCATAGCGTTGTGGGAAA...

CDS

Download CDS FASTA

945 bp · LXL04_005524|LXL04_005524|OH1004|CDS

ATGGGGCAGCATTCATGTTGCAACCAGCAGAAGGTTAAAAGAGGGCTTTGGTCACCTGAGGAAGATGAAAAGCTCATTAAGTTCATCACAACTCATGGCTACGGCTGCTGGAGTGAAGTCCCAGAGAAAGCTGGGCTTCAAAGATGCGGAAAGAGTTGTCGATTGAGATGGATAAACTATTTGAGACCCGATATCCGAAGAGGAAAGTTTACACCTGAGGAAGAAAAGTTGATCATCAATCTTCATAGCGTTGTGGGAAA...

Protein

Download Protein FASTA

314 aa · LXL04_005524|LXL04_005524|OH1004|PROTEIN

MGQHSCCNQQKVKRGLWSPEEDEKLIKFITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYLRPDIRRGKFTPEEEKLIINLHSVVGNKWAHIASHLPGRTDNEIKNYWNSWIKKKINRKPTSTSMITRLNTTSTSIDQPHTDYGYNPTHLSFLNQDLCIKQPNQETAFSSSLSSLFMLDTSGSVLEGHNGDFISHTEYFNDSMWPMSKHQIPELPSLNFTTNNMYSGYLPPLMENLEGMVHGQNGELNNGEGRECVIQKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005524`
TK1151 ID	TkA01G037580
OH-1004 ID	LXL04_005524
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 40.764 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005524

Location Chr01:166644712-166647367 (+)

Description Similar to MYB61: Transcription factor MYB61

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09540`	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation.	AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.06.041 MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.2009 · DOI: 10.1093/jxb/erp102 AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.2012 · DOI: 10.1111/j.1469-8137.2012.04201.x Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.2013 · DOI: 10.1371/journal.pone.0065132 AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13509
`At3g13890`	Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence.	Disruption of Arabidopsis thaliana MYB26 results in male sterility due to non-dehiscent anthers.2003 · DOI: 10.1046/j.1365-313x.2003.01745.x Efficient production of male and female sterile plants by expression of a chimeric repressor in Arabidopsis and rice.2006 · DOI: 10.1111/j.1467-7652.2006.00184.x Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence.2007 · DOI: 10.1105/tpc.106.046391
`At5g26660`	Probable transcription factor.	No verified direct reference in this release
`At4g34990`	Transcription factor MYB32.	No verified direct reference in this release
`At3g01140`	Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation.	Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.2008 · DOI: 10.1104/pp.108.126979 MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.2013 · DOI: 10.1105/tpc.113.110783 The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.2013 · DOI: 10.4161/psb.26826

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005524 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010091 trichome branching Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010214 seed coat development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G09540

ath:AT3G01140

ath:AT3G13890

ath:AT4G34990

ath:AT5G26660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.949

Rank 1 · LXL04_005524 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_005524 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_005524 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_005524 · OH-1004

Mitochondrion0.012

Rank 5 · LXL04_005524 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding14-61 aa

PF13921.13Myb_DNA-bind_617-76 aa

PF00249.38Myb_DNA-binding67-111 aa

PF13921.13Myb_DNA-bind_670-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005524	`PF00249.38`	Myb_DNA-binding	14	61	9.2e-37	125.6
LXL04_005524	`PF13921.13`	Myb_DNA-bind_6	17	76	2.6e-25	89.1
LXL04_005524	`PF00249.38`	Myb_DNA-binding	67	111	9.2e-37	125.6
LXL04_005524	`PF13921.13`	Myb_DNA-bind_6	70	129	2.6e-25	89.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZQ2`	Arabidopsis thaliana	Transcription factor MYB61	52.261%	Swiss-Prot	moderate database homology
`Q9SPG3`	Arabidopsis thaliana	Transcription factor MYB26	59.236%	Swiss-Prot	weak database homology
`Q8LPH6`	Arabidopsis thaliana	Transcription factor MYB86	63.448%	Swiss-Prot	weak database homology
`O49608`	Arabidopsis thaliana	Transcription factor MYB32	55.782%	Swiss-Prot	weak database homology
`Q9LE63`	Arabidopsis thaliana	Transcription factor MYB106	63.793%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card