LXL04_005422 | RubberDandelionOmics

Gene overview

LXL04_005422

Reference: OH-1004 Chr: Chr01 Coordinates: 163457566-163460688 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1365 bp · LXL04_005422|LXL04_005422|OH1004|cDNA

ATGCCTTTGAAATCGGAAGATCCTATCGCAAACAGGGAGAGAGGAATTCAAAATTCCATTCTTGAAAAACGCTCTCTAGGAGCTGGCCGGAGCAGGTGGTATGAAAATCGGAGAAAAGGAGGAGTCGACGGCTGGAATACTGTCAACATGCGAGCAAGAAAGAATTTGGAAGAACAGGGTGCAAAATGGTCGTTCACAGACGCCACTAACATCTTCATCTCAAACTTACCAGAAGTTTTGGACTCCCAAATGTTGCGAGA...

CDS

Download CDS FASTA

1365 bp · LXL04_005422|LXL04_005422|OH1004|CDS

ATGCCTTTGAAATCGGAAGATCCTATCGCAAACAGGGAGAGAGGAATTCAAAATTCCATTCTTGAAAAACGCTCTCTAGGAGCTGGCCGGAGCAGGTGGTATGAAAATCGGAGAAAAGGAGGAGTCGACGGCTGGAATACTGTCAACATGCGAGCAAGAAAGAATTTGGAAGAACAGGGTGCAAAATGGTCGTTCACAGACGCCACTAACATCTTCATCTCAAACTTACCAGAAGTTTTGGACTCCCAAATGTTGCGAGA...

Protein

Download Protein FASTA

454 aa · LXL04_005422|LXL04_005422|OH1004|PROTEIN

MPLKSEDPIANRERGIQNSILEKRSLGAGRSRWYENRRKGGVDGWNTVNMRARKNLEEQGAKWSFTDATNIFISNLPEVLDSQMLREKLNSLGTMVDLIIANRRDKHGYKFGFVRYNRVEDLNQFIGRLNRVKINGRNLFAKEASFKRKEKKMTEVNKINGNPRPSRSFINPVVRKGSIYAEAVTGQTGSSKEPISQHPETFRFKTREIKIAIEEGMDRAKDLKSRFIGEAKVAFVFRLEVLLATFVCAVQMARRRRGVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005422`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005422

Location Chr01:163457566-163460688 (-)

Description Similar to MAP70.4: Microtubule-associated protein 70-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14840`	Plant-specific protein that interact with microtubules.	No verified direct reference in this release
`At2g01750`	Plant-specific protein that interact with microtubules.	No verified direct reference in this release
`At1g24764`	Plant-specific protein that interact with microtubules.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0251700`	Plant-specific protein that interact with microtubules.	No verified direct reference in this release
`Os02g0736100`	Plant-specific protein that interact with microtubules.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005422 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007010 cytoskeleton organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010005 cortical microtubule, transverse to long axis Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G14840

ath:AT1G24764

ath:AT2G01750

dosa:Os02g0736100

dosa:Os06g0251700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.359

Rank 1 · LXL04_005422 · OH-1004

Nucleus0.354

Rank 2 · LXL04_005422 · OH-1004

Plastid0.117

Rank 3 · LXL04_005422 · OH-1004

Mitochondrion0.113

Rank 4 · LXL04_005422 · OH-1004

Cell membrane0.073

Rank 5 · LXL04_005422 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_171-139 aa

PF07058.17MAP70348-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005422	`PF00076.29`	RRM_1	71	139	1.9e-09	38.0
LXL04_005422	`PF07058.17`	MAP70	348	414	5.5e-24	85.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQU7`	Arabidopsis thaliana	Microtubule-associated protein 70-4	67.416%	Swiss-Prot	weak database homology
`Q9ZUA3`	Arabidopsis thaliana	Microtubule-associated protein 70-3	61.957%	Swiss-Prot	weak database homology
`Q8L7S4`	Arabidopsis thaliana	Microtubule-associated protein 70-2	80.000%	Swiss-Prot	weak database homology
`Q653N3`	Oryza sativa subsp. japonica	Microtubule-associated protein 70-3	78.788%	Swiss-Prot	weak database homology
`Q6Z746`	Oryza sativa subsp. japonica	Microtubule-associated protein 70-2	61.957%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card