LXL04_005407 | RubberDandelionOmics

Gene overview

LXL04_005407

Reference: OH-1004 Chr: Chr01 Coordinates: 162810684-162814329 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1861 bp · LXL04_005407|LXL04_005407|OH1004|cDNA

CAACTTACATACAGCTAACTTCTGGTGAGCAAAAATGGCGACTGGACAAATCTTCTCCCGTACAACACAAGCATTATTCTACAACTACAAACAGTTACCAATTCAACGGATGCTTGATTTTGACTTCCTTTGTGGGAGAGAAACACCATCAGTTGCTGGAATCATCAACCCTGGTGCAGAGGGATTCCAGAAACTATTTTTCGGTCAAGAGGAAATCGCCATTCCAGTACATTCAACAATCGAAGCAGCTTGTGCTGCAC...

CDS

Download CDS FASTA

1827 bp · LXL04_005407|LXL04_005407|OH1004|CDS

ATGGCGACTGGACAAATCTTCTCCCGTACAACACAAGCATTATTCTACAACTACAAACAGTTACCAATTCAACGGATGCTTGATTTTGACTTCCTTTGTGGGAGAGAAACACCATCAGTTGCTGGAATCATCAACCCTGGTGCAGAGGGATTCCAGAAACTATTTTTCGGTCAAGAGGAAATCGCCATTCCAGTACATTCAACAATCGAAGCAGCTTGTGCTGCACATCCTACTGCTGATGTATTCATAAACTTTGCATC...

Protein

Download Protein FASTA

608 aa · LXL04_005407|LXL04_005407|OH1004|PROTEIN

MATGQIFSRTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINPGAEGFQKLFFGQEEIAIPVHSTIEAACAAHPTADVFINFASFRSAAASSKLALKQPTIRVVAIIAEGVPESDTKELISYARSNNKVVIGPATVGGIQAGAFKIGDTAGTIDNIIQCKLYRPGSVGFVSKSGGMSNELYNTIARVTDGLYEGIAIGGDVFPGSTLSDHVLRFNNIPQIKMIVVLGELGGRDEYSLVEALKSGKISKPVCAWVSGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005407`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005407

Location Chr01:162810684-162814329 (+)

Description Similar to ACLB-1: ATP-citrate synthase beta chain protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49460`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	Molecular characterization of a heteromeric ATP-citrate lyase that generates cytosolic acetyl-coenzyme A in Arabidopsis.2002 · DOI: 10.1104/pp.008110
`At3g06650`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0300200`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005407 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006085 acetyl-CoA biosynthetic process Biological Process

GO:0006101 citrate metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0140615 ATP-dependent citrate lyase complex Cellular Component

GO:0003878 ATP citrate synthase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016829 lyase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G06650

ath:AT5G49460

ddi:DDB_G0278345

dosa:Os01g0300200

spo:2539879

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.486

Rank 1 · LXL04_005407 · OH-1004

Mitochondrion0.250

Rank 2 · LXL04_005407 · OH-1004

Peroxisome0.214

Rank 3 · LXL04_005407 · OH-1004

Nucleus0.129

Rank 4 · LXL04_005407 · OH-1004

Cell membrane0.055

Rank 5 · LXL04_005407 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00549.25Ligase_CoA173-298 aa

PF00285.27Citrate_synt401-597 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005407	`PF00549.25`	Ligase_CoA	173	298	6.5e-18	65.9
LXL04_005407	`PF00285.27`	Citrate_synt	401	597	6.9e-20	72.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGX1`	Arabidopsis thaliana	ATP-citrate synthase beta chain protein 2	90.789%	Swiss-Prot	strong database homology
`Q9C522`	Arabidopsis thaliana	ATP-citrate synthase beta chain protein 1	90.132%	Swiss-Prot	strong database homology
`Q93VT8`	Oryza sativa subsp. japonica	ATP-citrate synthase beta chain protein 1	90.789%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card