LXL04_005324 | RubberDandelionOmics

Gene overview

LXL04_005324

Reference: OH-1004 Chr: Chr01 Coordinates: 160418603-160421566 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1377 bp · LXL04_005324|LXL04_005324|OH1004|cDNA

ATGGCATCAGACGGCTGGAAAAACTCCAACAAATTGCCATTATTTTACACACCGATCTTTCTCATTCTCTTCTTCGTTTGCCTCAATACCCAGTTCAATTTCTTCACTTTTTCATCCATAAAAATCTATTTATTCTCTCCCACTCCGgcgccaccaccgccgccgTCGACCACCAGCCATGCATATGTGAATAAGGAGGAAAGTATAGAGGAACGGTTGACACGTGCTCGTGTTGCCATACTAGAAGCTGGTAAGAAGAG...

CDS

Download CDS FASTA

1377 bp · LXL04_005324|LXL04_005324|OH1004|CDS

ATGGCATCAGACGGCTGGAAAAACTCCAACAAATTGCCATTATTTTACACACCGATCTTTCTCATTCTCTTCTTCGTTTGCCTCAATACCCAGTTCAATTTCTTCACTTTTTCATCCATAAAAATCTATTTATTCTCTCCCACTCCGGCGCCACCACCGCCGCCGTCGACCACCAGCCATGCATATGTGAATAAGGAGGAAAGTATAGAGGAACGGTTGACACGTGCTCGTGTTGCCATACTAGAAGCTGGTAAGAAGAG...

Protein

Download Protein FASTA

458 aa · LXL04_005324|LXL04_005324|OH1004|PROTEIN

MASDGWKNSNKLPLFYTPIFLILFFVCLNTQFNFFTFSSIKIYLFSPTPAPPPPPSTTSHAYVNKEESIEERLTRARVAILEAGKKRRYKMPWRFNDRSFIPKGSVYRNPYAFHQSHIEMEKIFKVWAYKEGELPIFHGGPMNNIYSSEGQIIDEIESQKSRFFAHNPEEAIVFFLPVSVVAIRHYLYKPHFDYDRRIIQDVVSDYIEVLSNRYPYWNRSNGADHFFVSCHDWSLTLFQAPDVTATKPKLYEHFIRVLCN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005324`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005324

Location Chr01:160418603-160421566 (-)

Description Similar to At5g11130/At5g11120: Probable glycosyltransferase At5g11130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9LFP3`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At5g20260`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At3g42180`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At5g33290`	Involved in pectin biosynthesis.	Identification of a xylogalacturonan xylosyltransferase involved in pectin biosynthesis in Arabidopsis.2008 · DOI: 10.1105/tpc.107.050906
`At5g03795`	May be involved in cell wall biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005324 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0010398 xylogalacturonan metabolic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G42180

ath:AT5G03795

ath:AT5G11130

ath:AT5G20260

ath:AT5G33290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.765

Rank 1 · LXL04_005324 · OH-1004

Endoplasmic reticulum0.095

Rank 2 · LXL04_005324 · OH-1004

Cell membrane0.051

Rank 3 · LXL04_005324 · OH-1004

Cytoplasm0.036

Rank 4 · LXL04_005324 · OH-1004

Nucleus0.031

Rank 5 · LXL04_005324 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03016.21Exostosin_GT47106-409 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005324	`PF03016.21`	Exostosin_GT47	106	409	4.6e-61	207.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFP3`	Arabidopsis thaliana	Probable glycosyltransferase At5g11130	53.178%	Swiss-Prot	strong database homology
`Q3E9A4`	Arabidopsis thaliana	Probable glycosyltransferase At5g20260	58.481%	Swiss-Prot	strong database homology
`Q3EAR7`	Arabidopsis thaliana	Probable glycosyltransferase At3g42180	57.377%	Swiss-Prot	strong database homology
`Q94AA9`	Arabidopsis thaliana	Xylogalacturonan beta-1,3-xylosyltransferase	53.867%	Swiss-Prot	strong database homology
`Q9FFN2`	Arabidopsis thaliana	Probable glycosyltransferase At5g03795	49.872%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card