Gene Card
Gene overview
cDNA / CDS / Protein Sequences
546 bp · LXL04_005260|LXL04_005260|OH1004|cDNA
ATGTCAGGTGCCATTGTTATTGGAGCGTCAAGCTCATGGGCAAGAGCCCTGGTTAAGATCTCCCCGTATACTTTCTCTGCCATTGGTATCGCGATTTCAATCGGCGTCTCCGTCTTAGGCGCCGCCTGGGGAATTTACATAACGGGAAGTAGTTTGATCGGTGCGGCAATCAAAGCTCCTCGTATTACGTCAAAGAATCTTATAAGCGTCATCTTCTGTGAAGCCGTTGCTATATACGGTGTTATCGTAGCCATTATTCT...
546 bp · LXL04_005260|LXL04_005260|OH1004|CDS
ATGTCAGGTGCCATTGTTATTGGAGCGTCAAGCTCATGGGCAAGAGCCCTGGTTAAGATCTCCCCGTATACTTTCTCTGCCATTGGTATCGCGATTTCAATCGGCGTCTCCGTCTTAGGCGCCGCCTGGGGAATTTACATAACGGGAAGTAGTTTGATCGGTGCGGCAATCAAAGCTCCTCGTATTACGTCAAAGAATCTTATAAGCGTCATCTTCTGTGAAGCCGTTGCTATATACGGTGTTATCGTAGCCATTATTCT...
Protein
Download Protein FASTA181 aa · LXL04_005260|LXL04_005260|OH1004|PROTEIN
MSGAIVIGASSSWARALVKISPYTFSAIGIAISIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLISVIFCEAVAIYGVIVAIILQTKLESVPSSQIYEPESLRAGYAIFASGIIVGFANLVCGLCVGIIGSSCALSDAQNSSLFVKILVIEIFGSALGLFGVIVGIIMSAQATWPSKV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005260 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005260 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:159142674-159143678 (-) | |||||||||
| Description | Similar to VHA-c''1: V-type proton ATPase subunit c''1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007035 vacuolar acidification Biological Process GO:0007042 lysosomal lumen acidification Biological Process GO:0016241 regulation of macroautophagy Biological Process GO:0045851 pH reduction Biological Process GO:0048388 endosomal lumen acidification Biological Process GO:0051452 intracellular pH reduction Biological Process GO:0061795 Golgi lumen acidification Biological Process GO:1902600 proton transmembrane transport Biological Process GO:0000139 Golgi membrane Cellular Component GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005768 endosome Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G25610 ath:AT4G32530 bta:505684 hsa:533 mmu:114143 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00137.27ATP-synt_C28-87 aaPF00137.27ATP-synt_C112-171 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_005260 | PF00137.27 | ATP-synt_C | 28 | 87 | 1.3e-29 | 102.9 |
| LXL04_005260 | PF00137.27 | ATP-synt_C | 112 | 171 | 1.3e-29 | 102.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.