LXL04_005233 | RubberDandelionOmics

Gene overview

LXL04_005233

Reference: OH-1004 Chr: Chr01 Coordinates: 158090949-158091930 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

747 bp · LXL04_005233|LXL04_005233|OH1004|cDNA

ATGGCGAAGATCGCGATCGGCTCAATTAAGGAGGTGATCAGTCCCGACTGCATCCAAGCGCTCGTTGTCGAGTTCATCGTCACGTTTCTTTTCATCTTTGCCGGTGTCGGATCCGCCATGACCACAGAAAAGTTGGTGGGAAATGAGGTGGTGGGGCTGTTTTTCGTGGCAATGGCTCACGCATTTGTGGTGGCGGTGATGATATCGGCTGGTTTTAGAATCTCCGGCGGTCATCTGAATCCGGCAGTCACTCTCGGCCT...

CDS

Download CDS FASTA

747 bp · LXL04_005233|LXL04_005233|OH1004|CDS

ATGGCGAAGATCGCGATCGGCTCAATTAAGGAGGTGATCAGTCCCGACTGCATCCAAGCGCTCGTTGTCGAGTTCATCGTCACGTTTCTTTTCATCTTTGCCGGTGTCGGATCCGCCATGACCACAGAAAAGTTGGTGGGAAATGAGGTGGTGGGGCTGTTTTTCGTGGCAATGGCTCACGCATTTGTGGTGGCGGTGATGATATCGGCTGGTTTTAGAATCTCCGGCGGTCATCTGAATCCGGCAGTCACTCTCGGCCT...

Protein

Download Protein FASTA

248 aa · LXL04_005233|LXL04_005233|OH1004|PROTEIN

MAKIAIGSIKEVISPDCIQALVVEFIVTFLFIFAGVGSAMTTEKLVGNEVVGLFFVAMAHAFVVAVMISAGFRISGGHLNPAVTLGLCVGGHITVVRSVLYWIDQLLASVAACALLSYLSGGLATPVHTLAAGMDSLQGVIMEIVLTFSLLFTVYATLVDPKKGFLNGLGPLLTGLVVGANIMAAGAFSGASMNPARSFGPALVAGDWTDHWVYWVGPLIGGGLAGFIYENFFIVRTHVPLARDDEGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005233`
TK1151 ID	TkA01G074560
OH-1004 ID	LXL04_005233
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005233

Location Chr01:158090949-158091930 (-)

Description Similar to TIP4-1: Aquaporin TIP4-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25810`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At3g16240`	Aquaporin required to facilitate the transport of water from the vacuolar compartment to the cytoplasm.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0231700`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005233 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0015840 urea transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000326 protein storage vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT2G25810

ath:AT3G16240

dosa:Os05g0231700

nta:107817944

zma:542647

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.445

Rank 1 · LXL04_005233 · OH-1004

Cell membrane0.258

Rank 2 · LXL04_005233 · OH-1004

Endoplasmic reticulum0.189

Rank 3 · LXL04_005233 · OH-1004

Cytoplasm0.099

Rank 4 · LXL04_005233 · OH-1004

Golgi apparatus0.070

Rank 5 · LXL04_005233 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230.26MIP14-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005233	`PF00230.26`	MIP	14	229	1e-68	232.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82316`	Arabidopsis thaliana	Aquaporin TIP4-1	76.423%	Swiss-Prot	strong database homology
`Q41951`	Arabidopsis thaliana	Aquaporin TIP2-1	58.233%	Swiss-Prot	strong database homology
`Q75GA5`	Oryza sativa subsp. japonica	Probable aquaporin TIP4-1	56.250%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card