LXL04_005207 | RubberDandelionOmics

Gene overview

LXL04_005207

Reference: OH-1004 Chr: Chr01 Coordinates: 157740790-157742252 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · LXL04_005207|LXL04_005207|OH1004|cDNA

ATGGAAGTAGAAATGGATGTTTCAGGAGTTCACCGCCATTATCAGCAACAGGAGATGTCTTCACATACGCTTGAGAGCATGTTGGTGTGCAATAAAGCACAACAAGATAAGAAACCAAAGCCGCCGGAGGAAGCTCTGAAATGCCCACGATGTGATTCCGGCAACACCAAATTCTGCTACTACAACAACTACAGCCTCACTCAGCCGCGATACTTCTGCAAATCCTGCCGGAGGTACTGGACCAAAGGCGGAACTCTAAG...

CDS

Download CDS FASTA

1110 bp · LXL04_005207|LXL04_005207|OH1004|CDS

ATGGAAGTAGAAATGGATGTTTCAGGAGTTCACCGCCATTATCAGCAACAGGAGATGTCTTCACATACGCTTGAGAGCATGTTGGTGTGCAATAAAGCACAACAAGATAAGAAACCAAAGCCGCCGGAGGAAGCTCTGAAATGCCCACGATGTGATTCCGGCAACACCAAATTCTGCTACTACAACAACTACAGCCTCACTCAGCCGCGATACTTCTGCAAATCCTGCCGGAGGTACTGGACCAAAGGCGGAACTCTAAG...

Protein

Download Protein FASTA

369 aa · LXL04_005207|LXL04_005207|OH1004|PROTEIN

MEVEMDVSGVHRHYQQQEMSSHTLESMLVCNKAQQDKKPKPPEEALKCPRCDSGNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSSSSSSATSPISSSASALSKLRGTQDHHLIQQHHHQHPLNIIASNSNNHLLSNLAHLPYDSTDLSLAFARLQGQANGHLGFDQFDQNDPSSNSNHQLTSHGDQLGFLDAIRGGFLDNTSNGFHNVLYSGGNNIGNGEMASLGNLMGLNNGNNSHGQDQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005207`
TK1151 ID	TkA01G076090
OH-1004 ID	LXL04_005207
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005207

Location Chr01:157740790-157742252 (-)

Description Similar to DOF5.3: Dof zinc finger protein DOF5.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60200`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At2g28510`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At3g45610`	Transcription factor that negatively affects seed germination and opposes TCP14 function in the regulation of a specific set of abscisic acid-related genes.	Arabidopsis thaliana DOF6 negatively affects germination in non-after-ripened seeds and interacts with TCP14.2012 · DOI: 10.1093/jxb/err388 Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At3g61850`	Transcription factor specifically involved in the maternal control of seed germination.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005207 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009845 seed germination Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G28510

ath:AT3G45610

ath:AT3G61850

ath:AT5G60200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · LXL04_005207 · OH-1004

Cytoplasm0.074

Rank 2 · LXL04_005207 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_005207 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_005207 · OH-1004

Plastid0.010

Rank 5 · LXL04_005207 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02701.21Zn_ribbon_Dof44-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005207	`PF02701.21`	Zn_ribbon_Dof	44	100	7.7e-34	116.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TE9`	Arabidopsis thaliana	Dof zinc finger protein DOF5.3	54.730%	Swiss-Prot	weak database homology
`Q8LE43`	Arabidopsis thaliana	Dof zinc finger protein DOF2.1	33.244%	Swiss-Prot	moderate database homology
`Q9M1E6`	Arabidopsis thaliana	Dof zinc finger protein DOF3.2	44.199%	Swiss-Prot	weak database homology
`Q43385`	Arabidopsis thaliana	Dof zinc finger protein DOF3.7	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card