LXL04_005020 | RubberDandelionOmics

Gene overview

LXL04_005020

Reference: OH-1004 Chr: Chr01 Coordinates: 153104058-153105727 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

837 bp · LXL04_005020|LXL04_005020|OH1004|cDNA

ATGTCGCTTCTGGTTTCTCTCCCCACTGTCGCTACTTTATTCACCGCCACCGCTTTTTCTGGTATCTACAGAAACATGTTTCAGGCTTATATCTCACACTGTTACTCCCAGGAACCTAAACCACAGCCAATCAAATATCGTGGAGTCGAACATCTCTCTGACATGCTCGCCAACTGCAATCAGACTTCAGGCATATTGTATTATGAAGTATTGAATCTCACTTTGCCAGGAGTACGAGGCCTTAAAACTCTGAAAGTTGC...

CDS

Download CDS FASTA

837 bp · LXL04_005020|LXL04_005020|OH1004|CDS

ATGTCGCTTCTGGTTTCTCTCCCCACTGTCGCTACTTTATTCACCGCCACCGCTTTTTCTGGTATCTACAGAAACATGTTTCAGGCTTATATCTCACACTGTTACTCCCAGGAACCTAAACCACAGCCAATCAAATATCGTGGAGTCGAACATCTCTCTGACATGCTCGCCAACTGCAATCAGACTTCAGGCATATTGTATTATGAAGTATTGAATCTCACTTTGCCAGGAGTACGAGGCCTTAAAACTCTGAAAGTTGC...

Protein

Download Protein FASTA

278 aa · LXL04_005020|LXL04_005020|OH1004|PROTEIN

MSLLVSLPTVATLFTATAFSGIYRNMFQAYISHCYSQEPKPQPIKYRGVEHLSDMLANCNQTSGILYYEVLNLTLPGVRGLKTLKVAFHHATKDEVVIHTIRLPKQSSIGDVAFRILETINSVNQRAIADTLEHDLQQETQGYVCDINQNLLDVGQKRAIKEIRLGEQESLIWVEGDAEKLKFENGSMDGYIIVFGIRNVTHIEKAIAETYRSVLKKGGRFLCLKLSHVEAHVFKQLYDYYSFSVIPVLRELVARDRDSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005020`
TK1151 ID	TkA01G084810
OH-1004 ID	LXL04_005020
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 91.007 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005020

Location Chr01:153104058-153105727 (-)

Description Similar to COQ5: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57300`	Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0976600`	Methyltransferase required for the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005020 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0031314 extrinsic component of mitochondrial inner membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0008425 2-methoxy-6-polyprenyl-1,4-benzoquinol methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G57300

dosa:Os01g0976600

gga:416975

hsa:84274

xla:734563

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.434

Rank 1 · LXL04_005020 · OH-1004

Cytoplasm0.166

Rank 2 · LXL04_005020 · OH-1004

Peroxisome0.139

Rank 3 · LXL04_005020 · OH-1004

Endoplasmic reticulum0.126

Rank 4 · LXL04_005020 · OH-1004

Nucleus0.090

Rank 5 · LXL04_005020 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01209.25Ubie_methyltran110-274 aa

PF13649.13Methyltransf_25139-219 aa

PF08241.19Methyltransf_11141-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005020	`PF01209.25`	Ubie_methyltran	110	274	5e-36	124.9
LXL04_005020	`PF13649.13`	Methyltransf_25	139	219	2e-06	29.1
LXL04_005020	`PF08241.19`	Methyltransf_11	141	223	1.1e-08	36.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVC8`	Arabidopsis thaliana	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	65.269%	Swiss-Prot	moderate database homology
`Q5JNC0`	Oryza sativa subsp. japonica	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	57.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card