LXL04_005001 | RubberDandelionOmics

Gene overview

LXL04_005001

Reference: OH-1004 Chr: Chr01 Coordinates: 152386595-152387101 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · LXL04_005001|LXL04_005001|OH1004|cDNA

ATGACAACAAGAAACTCCGGCCACCACCATCGACCTAAATTCCTCTACTTAGAAGCTCTCGTAGCGGATCAAAGAATCAGCTCTAACGATGAAGACAACTCCGAGACTATCAAATTCGACATctggaacagcaacaacgaTTATCTAATAATCTACCCAGAAAACCCCATCTCGAAATCTATGGTTAAATCAATAAAACCACCACTTAATTCTCACCGCAGCCAGAAAAGAACATTACCAGTTACCGGAAAGTCATCGCC...

CDS

Download CDS FASTA

507 bp · LXL04_005001|LXL04_005001|OH1004|CDS

ATGACAACAAGAAACTCCGGCCACCACCATCGACCTAAATTCCTCTACTTAGAAGCTCTCGTAGCGGATCAAAGAATCAGCTCTAACGATGAAGACAACTCCGAGACTATCAAATTCGACATCTGGAACAGCAACAACGATTATCTAATAATCTACCCAGAAAACCCCATCTCGAAATCTATGGTTAAATCAATAAAACCACCACTTAATTCTCACCGCAGCCAGAAAAGAACATTACCAGTTACCGGAAAGTCATCGCC...

Protein

Download Protein FASTA

168 aa · LXL04_005001|LXL04_005001|OH1004|PROTEIN

MTTRNSGHHHRPKFLYLEALVADQRISSNDEDNSETIKFDIWNSNNDYLIIYPENPISKSMVKSIKPPLNSHRSQKRTLPVTGKSSPVDVPDWPKILRDAYKQSDSNHVDDDDSCGACDDDWLPPHEYLARIGSASLSVHEGVGRRLKGRDLSRLRNAIWKETGFDQD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005001`
TK1151 ID	TkA02G545860
OH-1004 ID	LXL04_005001
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	50.600
Protein coverage (%)	TK1151 90.058 / OH-1004 94.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005001

Location Chr01:152386595-152387101 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28400`	Protein S40-4.	No verified direct reference in this release
`At1g61930`	Protein S40-6.	No verified direct reference in this release
`At1g11700`	Protein S40-5.	No verified direct reference in this release
`At3g15040`	Protein S40-7.	No verified direct reference in this release
`At1g29640`	Protein S40-1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005001 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010150 leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G11700

ath:AT1G29640

ath:AT1G61930

ath:AT2G28400

ath:AT3G15040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.525

Rank 1 · LXL04_005001 · OH-1004

Cytoplasm0.427

Rank 2 · LXL04_005001 · OH-1004

Cell membrane0.113

Rank 3 · LXL04_005001 · OH-1004

Endoplasmic reticulum0.062

Rank 4 · LXL04_005001 · OH-1004

Mitochondrion0.042

Rank 5 · LXL04_005001 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04520.19Senescence_reg63-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005001	`PF04520.19`	Senescence_reg	63	165	1.1e-32	114.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKN0`	Arabidopsis thaliana	Protein S40-4	50.000%	Swiss-Prot	weak database homology
`O80698`	Arabidopsis thaliana	Protein S40-6	47.191%	Swiss-Prot	weak database homology
`Q9SAA7`	Arabidopsis thaliana	Protein S40-5	46.591%	Swiss-Prot	weak database homology
`Q9LKA1`	Arabidopsis thaliana	Protein S40-7	40.698%	Swiss-Prot	weak database homology
`Q9C7N7`	Arabidopsis thaliana	Protein S40-1	38.835%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card