Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1311 bp · LXL04_004964|LXL04_004964|OH1004|cDNA
ATGAGTGCTTCTGCAAACGATGTTGAAGATCAAGGCGACGTTTTTCTTGATGAGGATGACATCGAGGAAGAAATCAATGTAGATGAAGAAGATCTTCCTGATGCAGAAGACGATGGCGACTCTGATGCCGAATCTTTTGATCTTCCTGATGCAGAAGACGATGGCGACTCTGATGCCGAATCTTTTGATGAAGCCGACAACTCAATGCACATATTCACCGGTCATTCCGGTGAATTATACACGGTTGCATGTAGCCCTAG...
1311 bp · LXL04_004964|LXL04_004964|OH1004|CDS
ATGAGTGCTTCTGCAAACGATGTTGAAGATCAAGGCGACGTTTTTCTTGATGAGGATGACATCGAGGAAGAAATCAATGTAGATGAAGAAGATCTTCCTGATGCAGAAGACGATGGCGACTCTGATGCCGAATCTTTTGATCTTCCTGATGCAGAAGACGATGGCGACTCTGATGCCGAATCTTTTGATGAAGCCGACAACTCAATGCACATATTCACCGGTCATTCCGGTGAATTATACACGGTTGCATGTAGCCCTAG...
Protein
Download Protein FASTA436 aa · LXL04_004964|LXL04_004964|OH1004|PROTEIN
MSASANDVEDQGDVFLDEDDIEEEINVDEEDLPDAEDDGDSDAESFDLPDAEDDGDSDAESFDEADNSMHIFTGHSGELYTVACSPRDAILVATGGGDDKGFVWKLGQDDYTFELQGHKDSVTSVAFSCDGQLVASGSFDGFVQVWDVSSETLKCTLDGPGAGIEWVRWHPRGHLVLAGSEDYTVWLWNIADVDAVYLTTFSGHASTVTCGDFTPDGKTICTGSDDATLRIWNGEHVHVVRGHFYHTQGLTCLTITADSS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_004964 |
|---|---|
| TK1151 ID | TkA01G093210 |
| OH-1004 ID | LXL04_004964 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 64.508 / OH-1004 57.110Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_004964 |
|---|---|
| Location | Chr01:151083212-151085149 (-) |
| Description | Similar to AAMP: Angio-associated migratory cell protein |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0010595 positive regulation of endothelial cell migration Biological Process GO:0014909 smooth muscle cell migration Biological Process GO:0030154 cell differentiation Biological Process GO:0180023 cytosolic large ribosomal subunit assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009986 cell surface Cellular Component GO:0030687 preribosome, large subunit precursor Cellular Component GO:0008201 heparin binding Molecular Function |
| KEGG gene cross-reference | bta:767919 cfa:478908 hsa:14 pon:100172186 spo:2542715 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24105.2Beta-prop_CAF1B_HIR157-152 aaPF25391.2WD40_Gbeta64-233 aaPF25175.2Beta-prop_WDR566-155 aaPF25173.2Beta-prop_WDR3_1st67-233 aaPF23381.2Beta-prop_IFT122_1st68-147 aaPF24817.2WD40_WDHD1_1st69-154 aaPF25047.1Beta-prop_TEP1_2nd69-151 aaPF25171.2Beta-prop_WDR36-Utp21_1st69-177 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_004964 | PF24105.2 | Beta-prop_CAF1B_HIR1 | 57 | 152 | 1.3e-21 | 77.8 |
| LXL04_004964 | PF25391.2 | WD40_Gbeta | 64 | 233 | 1e-21 | 78.1 |
| LXL04_004964 | PF25175.2 | Beta-prop_WDR5 | 66 | 155 | 7.5e-56 | 190.3 |
| LXL04_004964 | PF25173.2 | Beta-prop_WDR3_1st | 67 | 233 | 6.1e-81 | 271.2 |
| LXL04_004964 | PF23381.2 | Beta-prop_IFT122_1st | 68 | 147 | 7.6e-46 | 157.4 |
| LXL04_004964 | PF24817.2 | WD40_WDHD1_1st | 69 | 154 | 2.2e-32 | 113.1 |
| LXL04_004964 | PF25047.1 | Beta-prop_TEP1_2nd | 69 | 151 | 2.1e-26 | 93.4 |
| LXL04_004964 | PF25171.2 | Beta-prop_WDR36-Utp21_1st | 69 | 177 | 2.1e-17 | 64.1 |
| LXL04_004964 | PF25174.2 | Beta-prop_THOC3 | 70 | 297 | 3.2e-45 | 155.0 |
| LXL04_004964 | PF23409.2 | Beta-prop_EML | 72 | 280 | 6.4e-17 | 62.6 |
| LXL04_004964 | PF23869.2 | Beta-prop_WDR75_1st | 74 | 178 | 5.6e-15 | 56.2 |
| LXL04_004964 | PF23414.2 | Beta-prop_EML_2 | 79 | 221 | 1e-30 | 107.7 |
| LXL04_004964 | PF29037.1 | DSE1_N | 79 | 151 | 1.2e-13 | 51.6 |
| LXL04_004964 | PF24796.2 | WDR55 | 80 | 156 | 6.7e-24 | 85.2 |
| LXL04_004964 | PF20426.5 | NBCH_WD40 | 80 | 151 | 7.7e-18 | 65.2 |
| LXL04_004964 | PF24814.2 | WD40_Prp19 | 81 | 235 | 7.9e-44 | 150.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.