LXL04_004891 | RubberDandelionOmics

Gene overview

LXL04_004891

Reference: OH-1004 Chr: Chr01 Coordinates: 149684956-149686596 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1641 bp · LXL04_004891|LXL04_004891|OH1004|cDNA

ATGGTGATTTCCTCTGCTTTCAAATTCAATCTCTTCCTCATCATCACCTCCTGCGCAACCTCCTACGGCGATTCCGCCATAACCACCACCTGCACCGCCATCCACCAGCAAAATTCCCCCACCGCCAAGTGTAATTACGTAAAAACAAACCCCGGATGTGACCCAAAAGGATACATcaattacctacaaatcttctactGTAATTTCTCCCAGTTTCCTCAACTGGGTTTCGTTCTGTTTCTTCTATGGCTCGTTGTTCT...

CDS

Download CDS FASTA

1641 bp · LXL04_004891|LXL04_004891|OH1004|CDS

ATGGTGATTTCCTCTGCTTTCAAATTCAATCTCTTCCTCATCATCACCTCCTGCGCAACCTCCTACGGCGATTCCGCCATAACCACCACCTGCACCGCCATCCACCAGCAAAATTCCCCCACCGCCAAGTGTAATTACGTAAAAACAAACCCCGGATGTGACCCAAAAGGATACATCAATTACCTACAAATCTTCTACTGTAATTTCTCCCAGTTTCCTCAACTGGGTTTCGTTCTGTTTCTTCTATGGCTCGTTGTTCT...

Protein

Download Protein FASTA

546 aa · LXL04_004891|LXL04_004891|OH1004|PROTEIN

MVISSAFKFNLFLIITSCATSYGDSAITTTCTAIHQQNSPTAKCNYVKTNPGCDPKGYINYLQIFYCNFSQFPQLGFVLFLLWLVVLFYILSNTASEYFCPAVEHLSKTLNLSPAIAGTTLLPLGNGSTDVFSSIIAFTGTTDGGDIGLNSILGGAIFVSTVVVGVLSLLITYHRKIVTVDKPNFIRDVVFLLFTLSNLLIIITVGKITIWASLLFVSTYIIYILLVCYMHFHTTKTQKKIIDPNDDDYQTTTAPLLGSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004891`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004891

Location Chr01:149684956-149686596 (+)

Description Similar to CCX1: Cation/calcium exchanger 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17860`	Vacuolar membrane-localized H(+)-dependent K(+) and Na(+) transporter.	No verified direct reference in this release
`At3g14070`	May act as an endomembrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.	AtCCX3 is an Arabidopsis endomembrane H+ -dependent K+ transporter.2008 · DOI: 10.1104/pp.108.118810
`At1g54115`	Membrane-localized H(+)-dependent K(+) and Na(+) transporter.	AtCCX3 is an Arabidopsis endomembrane H+ -dependent K+ transporter.2008 · DOI: 10.1104/pp.108.118810
`At5g17850`	Membrane-localized H(+)-dependent K(+) and Na(+) transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004891 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0006813 potassium ion transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0010150 leaf senescence Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0035725 sodium ion transmembrane transport Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0043157 response to cation stress Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

KEGG gene cross-reference

ath:AT1G54115

ath:AT3G14070

ath:AT5G17850

ath:AT5G17860

mmu:170756

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.564

Rank 1 · LXL04_004891 · OH-1004

Lysosome / Vacuole0.226

Rank 2 · LXL04_004891 · OH-1004

Endoplasmic reticulum0.119

Rank 3 · LXL04_004891 · OH-1004

Cytoplasm0.090

Rank 4 · LXL04_004891 · OH-1004

Golgi apparatus0.048

Rank 5 · LXL04_004891 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699.30Na_Ca_ex81-228 aa

PF01699.30Na_Ca_ex379-531 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004891	`PF01699.30`	Na_Ca_ex	81	228	1.4e-51	175.1
LXL04_004891	`PF01699.30`	Na_Ca_ex	379	531	1.4e-51	175.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKP1`	Arabidopsis thaliana	Cation/calcium exchanger 1	48.008%	Swiss-Prot	moderate database homology
`Q9LJI2`	Arabidopsis thaliana	Cation/calcium exchanger 3	41.547%	Swiss-Prot	moderate database homology
`Q9SYG9`	Arabidopsis thaliana	Cation/calcium exchanger 4	41.935%	Swiss-Prot	moderate database homology
`Q9FKP2`	Arabidopsis thaliana	Cation/calcium exchanger 2	42.471%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card