LXL04_004846 | RubberDandelionOmics

Gene overview

LXL04_004846

Reference: OH-1004 Chr: Chr01 Coordinates: 148657786-148659007 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · LXL04_004846|LXL04_004846|OH1004|cDNA

ATGTTGAGAAACCAGCTCAGAACACCATTGACAACCTTCATTCGGAAAACGCTACCTCAATCTGTTTCTCTCCAATCACTCGAAGAAAACATCACCCAATTGCAAAATCAACCAAATTTCTCTACTCCGTCTGGCTTCAATACTAACCCAACAGGGGTTTCAAGGAATATTCGATTTCAGCCTATATGGAACTCCGAATTTCTTGGAAAAAGTTCCGGTTTTTGTTCATCAGGGTCTTCCGATGAAACCACGTGCTGCTG...

CDS

Download CDS FASTA

816 bp · LXL04_004846|LXL04_004846|OH1004|CDS

ATGTTGAGAAACCAGCTCAGAACACCATTGACAACCTTCATTCGGAAAACGCTACCTCAATCTGTTTCTCTCCAATCACTCGAAGAAAACATCACCCAATTGCAAAATCAACCAAATTTCTCTACTCCGTCTGGCTTCAATACTAACCCAACAGGGGTTTCAAGGAATATTCGATTTCAGCCTATATGGAACTCCGAATTTCTTGGAAAAAGTTCCGGTTTTTGTTCATCAGGGTCTTCCGATGAAACCACGTGCTGCTG...

Protein

Download Protein FASTA

271 aa · LXL04_004846|LXL04_004846|OH1004|PROTEIN

MLRNQLRTPLTTFIRKTLPQSVSLQSLEENITQLQNQPNFSTPSGFNTNPTGVSRNIRFQPIWNSEFLGKSSGFCSSGSSDETTCCWNCKSHGPFLICQSCGSIQPVDHSVDYFRIFGLERKFDIEVGSLEGKYKDWQKKLHPDLVHTKSAEEREYAAEQSARVIDAYTTLRKPLLRAIYLMRLEGIEVDEEQTVSEPELLGEIMEIREAVEEAMDAQALNQIHSQMEEKLGHWYEYFANAFRRKEYDDALKSIQRMTYY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004846`
TK1151 ID	TkA01G101710
OH-1004 ID	LXL04_004846
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 88.535 / OH-1004 51.292 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004846

Location Chr01:148657786-148659007 (+)

Description Similar to HSCB: Iron-sulfur cluster co-chaperone protein HscB homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06410`	Co-chaperone required for the assembly of iron-sulfur [Fe-S] clusters in both mitochondria and cytosol.	Dual localized AtHscB involved in iron sulfur protein biogenesis in Arabidopsis.2009 · DOI: 10.1371/journal.pone.0007662 Altered levels of AtHSCB disrupts iron translocation from roots to shoots.2016 · DOI: 10.1007/s11103-016-0537-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004846 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0044571 [2Fe-2S] cluster assembly Biological Process

GO:0051259 protein complex oligomerization Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:1990230 iron-sulfur cluster transfer complex Cellular Component

GO:0001671 ATPase activator activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G06410

hsa:150274

mmu:100900

vch:VC_0751

vco:VC0395_A0280

vcr:VC395_0768

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.893

Rank 1 · LXL04_004846 · OH-1004

Cytoplasm0.087

Rank 2 · LXL04_004846 · OH-1004

Plastid0.065

Rank 3 · LXL04_004846 · OH-1004

Nucleus0.058

Rank 4 · LXL04_004846 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_004846 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07743.19HSCB_C197-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004846	`PF07743.19`	HSCB_C	197	267	2.9e-16	60.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7K4`	Arabidopsis thaliana	Iron-sulfur cluster co-chaperone protein HscB homolog	50.758%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card