LXL04_004831 | RubberDandelionOmics

Gene overview

LXL04_004831

Reference: OH-1004 Chr: Chr01 Coordinates: 148385406-148394311 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5910 bp · LXL04_004831|LXL04_004831|OH1004|cDNA

ATGGGTCGTCCGGAACCTTCCGTATTGTTTGCACAAACATTTGCCCATGCACACCTTGATGAATATGTTGATGAGGTTATATTTTCCGAACCTGTTATTGTCAGTGCTTGTGAGTTTCTTGAACAAAgctcatcatcatcatctccagCAGTAACACTTATGGGGGCCACCTCACCTCCTTCATTTGCTCTAGAGGTCTTTGTTCATTGTGAAGGGGAGACAAGGTTTAGGCGGCTATGCCAGCCTTTTCTCTATTCCCC...

CDS

Download CDS FASTA

5910 bp · LXL04_004831|LXL04_004831|OH1004|CDS

ATGGGTCGTCCGGAACCTTCCGTATTGTTTGCACAAACATTTGCCCATGCACACCTTGATGAATATGTTGATGAGGTTATATTTTCCGAACCTGTTATTGTCAGTGCTTGTGAGTTTCTTGAACAAAGCTCATCATCATCATCTCCAGCAGTAACACTTATGGGGGCCACCTCACCTCCTTCATTTGCTCTAGAGGTCTTTGTTCATTGTGAAGGGGAGACAAGGTTTAGGCGGCTATGCCAGCCTTTTCTCTATTCCCC...

Protein

Download Protein FASTA

1969 aa · LXL04_004831|LXL04_004831|OH1004|PROTEIN

MGRPEPSVLFAQTFAHAHLDEYVDEVIFSEPVIVSACEFLEQSSSSSSPAVTLMGATSPPSFALEVFVHCEGETRFRRLCQPFLYSPSSSNVLEVEALVTSHLVVRGSYRSLSLVVYGNTGEDLGQFNLEVDLDTSLTNTVSIVEGNLEDLPPALNPLKSTIEEPLSPLKSLTLKTPIASDISLEIKQFLQLSFKILEMPNAGGSLNAVVNSLVSAAVAYSNQSLYRASASQNRSVDLEEESCFDFSQARKELLDVYSAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004831`
TK1151 ID	TkA01G103080
OH-1004 ID	LXL04_004831
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004831

Location Chr01:148385406-148394311 (-)

Description Similar to VIR: Protein virilizer homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05680`	Subunit of the N6-methyltransferase complex, a multiprotein complex that mediates N6-methyladenosine (m6A) methylation at the 5'-[AG]GAC-3' consensus sites of some mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004831 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001510 RNA methylation Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010117 photoprotection Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0036396 RNA N6-methyladenosine methyltransferase complex Cellular Component

GO:0008174 mRNA methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G05680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.524

Rank 1 · LXL04_004831 · OH-1004

Cytoplasm0.326

Rank 2 · LXL04_004831 · OH-1004

Endoplasmic reticulum0.093

Rank 3 · LXL04_004831 · OH-1004

Cell membrane0.093

Rank 4 · LXL04_004831 · OH-1004

Golgi apparatus0.092

Rank 5 · LXL04_004831 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J8G7`	Arabidopsis thaliana	Protein virilizer homolog	51.829%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card