LXL04_004814 | RubberDandelionOmics

Gene overview

LXL04_004814

Reference: OH-1004 Chr: Chr01 Coordinates: 147295915-147299840 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · LXL04_004814|LXL04_004814|OH1004|cDNA

ATGGAAGGTGAAACAAGATCAAGATTCAAGAGAATATGCGTCTTTTGTGGTAGTAGCTCAGGGAAGAAACCAAGCTACCAAGAAGCTGCCATTGAGCTAGGCAAAGAACTgGTCGAAAAAAGGATTGATTTAGTCTATGGAGGTGGGAGCGTGGGTCTGATGGGTCTTGTTTCTCAGGCAGTTCATGATGGTGGGCGCCATGTTCTAGGGGTTATACCAAGGACTTTAATGCCACGAGAGATAACTGGAGAGACTGTTGG...

CDS

Download CDS FASTA

651 bp · LXL04_004814|LXL04_004814|OH1004|CDS

ATGGAAGGTGAAACAAGATCAAGATTCAAGAGAATATGCGTCTTTTGTGGTAGTAGCTCAGGGAAGAAACCAAGCTACCAAGAAGCTGCCATTGAGCTAGGCAAAGAACTGGTCGAAAAAAGGATTGATTTAGTCTATGGAGGTGGGAGCGTGGGTCTGATGGGTCTTGTTTCTCAGGCAGTTCATGATGGTGGGCGCCATGTTCTAGGGGTTATACCAAGGACTTTAATGCCACGAGAGATAACTGGAGAGACTGTTGG...

Protein

Download Protein FASTA

216 aa · LXL04_004814|LXL04_004814|OH1004|PROTEIN

MEGETRSRFKRICVFCGSSSGKKPSYQEAAIELGKELVEKRIDLVYGGGSVGLMGLVSQAVHDGGRHVLGVIPRTLMPREITGETVGEVKAVADMHERKAEMARQADAFIALPGGYGTLEELLEVITWAQLKIHHKPVGLLNVEGYYNSLLSFIDKAVDEGFISPTARRIIVSAPTAGQLVRQLEEFVPEYDEMAAKLTWDEVDRLNYVPEAGVPT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004814`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004814

Location Chr01:147295915-147299840 (+)

Description Similar to LOG7: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06300`	Cytokinin-activating enzyme working in the direct activation pathway.	No verified direct reference in this release
`At2g37210`	Cytokinin-activating enzyme working in the direct activation pathway.	No verified direct reference in this release
`At3g53450`	Cytokinin-activating enzyme working in the direct activation pathway.	No verified direct reference in this release
`At2g28305`	Cytokinin-activating enzyme working in the direct activation pathway.	Functional analyses of LONELY GUY cytokinin-activating enzymes reveal the importance of the direct activation pathway in Arabidopsis.2009 · DOI: 10.1105/tpc.109.068676

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0518800`	Cytokinin-activating enzyme working in the direct activation pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004814 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009691 cytokinin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0102682 cytokinin riboside 5'-monophosphate phosphoribohydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT2G28305

ath:AT2G37210

ath:AT3G53450

ath:AT5G06300

dosa:Os04g0518800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.724

Rank 1 · LXL04_004814 · OH-1004

Nucleus0.359

Rank 2 · LXL04_004814 · OH-1004

Mitochondrion0.095

Rank 3 · LXL04_004814 · OH-1004

Cell membrane0.078

Rank 4 · LXL04_004814 · OH-1004

Endoplasmic reticulum0.051

Rank 5 · LXL04_004814 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18306.7LDcluster416-142 aa

PF03641.20Lysine_decarbox54-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004814	`PF18306.7`	LDcluster4	16	142	5.5e-14	52.8
LXL04_004814	`PF03641.20`	Lysine_decarbox	54	184	3.3e-49	167.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GW29`	Arabidopsis thaliana	Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7	86.385%	Swiss-Prot	strong database homology
`Q8L8B8`	Arabidopsis thaliana	Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3	76.190%	Swiss-Prot	strong database homology
`Q9LFH3`	Arabidopsis thaliana	Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG4	76.699%	Swiss-Prot	strong database homology
`Q8RUN2`	Arabidopsis thaliana	Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1	76.329%	Swiss-Prot	strong database homology
`Q0JBP5`	Oryza sativa subsp. japonica	Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase LOGL6	74.762%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card