LXL04_004684 | RubberDandelionOmics

Gene overview

LXL04_004684

Reference: OH-1004 Chr: Chr01 Coordinates: 143326604-143329913 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2457 bp · LXL04_004684|LXL04_004684|OH1004|cDNA

ATGAAGGTTGAAACAAGATCACAGAATCATCCACCTGGAGACGAGGAAAAAATCATGACCAGGAAGCAGAAGGCGGAGAAACAAGAACATGATCAGCCAAACAAGAAAGCAAAATCGGAGGACAACAGCAATGGAAACAAAAAACCCCTAGCGGATATTGTCTCGGAGTTTGATAAGTTCTGTAAAACCACGAGTCAACATCTTTCCATCAGCCAGATGCGTAAAATTCTAGAAGCTAACAACGCGGACAGTTCAGGCTC...

CDS

Download CDS FASTA

2457 bp · LXL04_004684|LXL04_004684|OH1004|CDS

ATGAAGGTTGAAACAAGATCACAGAATCATCCACCTGGAGACGAGGAAAAAATCATGACCAGGAAGCAGAAGGCGGAGAAACAAGAACATGATCAGCCAAACAAGAAAGCAAAATCGGAGGACAACAGCAATGGAAACAAAAAACCCCTAGCGGATATTGTCTCGGAGTTTGATAAGTTCTGTAAAACCACGAGTCAACATCTTTCCATCAGCCAGATGCGTAAAATTCTAGAAGCTAACAACGCGGACAGTTCAGGCTC...

Protein

Download Protein FASTA

818 aa · LXL04_004684|LXL04_004684|OH1004|PROTEIN

MKVETRSQNHPPGDEEKIMTRKQKAEKQEHDQPNKKAKSEDNSNGNKKPLADIVSEFDKFCKTTSQHLSISQMRKILEANNADSSGSDDAVVPRCQDMMFYGALEECPICGGTLHYEDPNYICEGAYSEWSTCTYSTNDPPRTEEPIKYPDFVQDTPISDLLMEHKDRKGKQKRELKSMDKPFAGMLISLSGRLSRTHQYWKSKIEMHGGKVANSDIGVTCLVVAASERERGGSSKVTEALERGIPVVREAWLNDSIEKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004684`
TK1151 ID	TkA01G125090
OH-1004 ID	LXL04_004684
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004684

Location Chr01:143326604-143329913 (-)

Description Similar to PARP3: Protein ADP-ribosyltransferase PARP3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22470`	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0530600`	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism.	No verified direct reference in this release
`Os07g0413700`	Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004684 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006302 double-strand break repair Biological Process

GO:0070212 protein poly-ADP-ribosylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003950 NAD+ poly-ADP-ribosyltransferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016779 nucleotidyltransferase activity Molecular Function

GO:0051287 NAD binding Molecular Function

GO:0140806 NAD+-protein-aspartate ADP-ribosyltransferase activity Molecular Function

GO:0140807 NAD+-protein-glutamate ADP-ribosyltransferase activity Molecular Function

GO:1990404 NAD+-protein mono-ADP-ribosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G22470

dosa:Os02g0530600

dosa:Os07g0413700

gmx:548024

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.879

Rank 1 · LXL04_004684 · OH-1004

Cytoplasm0.191

Rank 2 · LXL04_004684 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_004684 · OH-1004

Mitochondrion0.027

Rank 4 · LXL04_004684 · OH-1004

Endoplasmic reticulum0.016

Rank 5 · LXL04_004684 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21728.4PADR1_N47-102 aa

PF08063.18Zn_ribbon_PADR1103-143 aa

PF00533.34BRCT181-257 aa

PF05406.21WGR329-407 aa

PF02877.20PARP_reg446-580 aa

PF00644.27PARP594-798 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004684	`PF21728.4`	PADR1_N	47	102	9.9e-17	61.8
LXL04_004684	`PF08063.18`	Zn_ribbon_PADR1	103	143	1.5e-14	54.2
LXL04_004684	`PF00533.34`	BRCT	181	257	2.7e-11	44.2
LXL04_004684	`PF05406.21`	WGR	329	407	3.1e-07	31.1
LXL04_004684	`PF02877.20`	PARP_reg	446	580	1.5e-21	77.6
LXL04_004684	`PF00644.27`	PARP	594	798	1e-54	185.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK91`	Arabidopsis thaliana	Protein ADP-ribosyltransferase PARP3	65.217%	Swiss-Prot	strong database homology
`Q0E0Q3`	Oryza sativa subsp. japonica	Protein ADP-ribosyltransferase PARP3	58.395%	Swiss-Prot	strong database homology
`Q7EYV7`	Oryza sativa subsp. japonica	Poly [ADP-ribose] polymerase 1	31.955%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card