LXL04_004674 | RubberDandelionOmics

Gene overview

LXL04_004674

Reference: OH-1004 Chr: Chr01 Coordinates: 143170180-143177201 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2421 bp · LXL04_004674|LXL04_004674|OH1004|cDNA

ATGCTTTCAGCCGGCGATGATTTCGTTATTTCGGCTATTTATACCTTCAGAACATGGTTGAAGAAAGGTACGCCACAGGATTCAAGGTACGCATTCACAGACAGGAAGAAAGTCAAACATGATAAAGCtatttcaaataaaaaaaaacagatGGGAAATGTGACCAACGTATATGGAAACTCGCCCTCTTCCAACCATACTGCTGCCCAACTGCGTTTGTACAAAGATTTTACTGAACTGAGTGTACCCACAAACTGTGA...

CDS

Download CDS FASTA

2421 bp · LXL04_004674|LXL04_004674|OH1004|CDS

ATGCTTTCAGCCGGCGATGATTTCGTTATTTCGGCTATTTATACCTTCAGAACATGGTTGAAGAAAGGTACGCCACAGGATTCAAGGTACGCATTCACAGACAGGAAGAAAGTCAAACATGATAAAGCTATTTCAAATAAAAAAAAACAGATGGGAAATGTGACCAACGTATATGGAAACTCGCCCTCTTCCAACCATACTGCTGCCCAACTGCGTTTGTACAAAGATTTTACTGAACTGAGTGTACCCACAAACTGTGA...

Protein

Download Protein FASTA

806 aa · LXL04_004674|LXL04_004674|OH1004|PROTEIN

MLSAGDDFVISAIYTFRTWLKKGTPQDSRYAFTDRKKVKHDKAISNKKKQMGNVTNVYGNSPSSNHTAAQLRLYKDFTELSVPTNCEVTFPNGNEDIMNFDFMIKPSEGFYRGGAFWFRANVGQMYPHFPPTVRCMTKVCHPYIDTDGNVFLNILYNDWKPVLQISQVLDAIYRLFTATFTSAESNMLDLTMDDCAGSSSGEKVYMPPPSKNLKLKRTYVYVSSMDNIYPSKRLRVSENDSMTIDEEKISKTVKLVHKIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004674`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004674

Location Chr01:143170180-143177201 (-)

Description Similar to RCE2: Probable NEDD8-conjugating enzyme Ubc12-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18600`	Accepts the ubiquitin-like protein NEDD8/RUB1 from the ECR1-AXR1 E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At4g36800`	Accepts the ubiquitin-like protein NEDD8/RUB1 from the ECR1-AXR1 E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004674 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0036211 protein modification process Biological Process

GO:0045116 protein neddylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019787 ubiquitin-like protein transferase activity Molecular Function

GO:0019788 NEDD8 transferase activity Molecular Function

GO:0061654 NEDD8 conjugating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT2G18600

ath:AT4G36800

xla:446800

xtr:394553

yli:2910945

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.513

Rank 1 · LXL04_004674 · OH-1004

Cytoplasm0.430

Rank 2 · LXL04_004674 · OH-1004

Mitochondrion0.072

Rank 3 · LXL04_004674 · OH-1004

Cell membrane0.072

Rank 4 · LXL04_004674 · OH-1004

Endoplasmic reticulum0.060

Rank 5 · LXL04_004674 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179.32UQ_con72-179 aa

PF05641.19Agenet526-584 aa

PF05641.19Agenet684-742 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004674	`PF00179.32`	UQ_con	72	179	1.2e-23	84.0
LXL04_004674	`PF05641.19`	Agenet	526	584	2.8e-25	89.3
LXL04_004674	`PF05641.19`	Agenet	684	742	2.8e-25	89.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU75`	Arabidopsis thaliana	Probable NEDD8-conjugating enzyme Ubc12-like	47.761%	Swiss-Prot	weak database homology
`Q9SDY5`	Arabidopsis thaliana	NEDD8-conjugating enzyme Ubc12	46.324%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card