LXL04_004573 | RubberDandelionOmics

Gene overview

LXL04_004573

Reference: OH-1004 Chr: Chr01 Coordinates: 140899186-140901960 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2466 bp · LXL04_004573|LXL04_004573|OH1004|cDNA

ATGAATCATTGTATTTTCATAGTTTTCTCACTTCACTTGCTACTCCTTGTGACTACAACCACCAGCCAATTGACAGCAGTTGTAGAAGGAGGAGATGATACTCAAGGTGTTACGAACAAGTGTTTTGATAAGGAGAGACATGCTCTCCTTTTTAAAGCTCCCATTCAAGACCCCTTTGATTCTTTCTCTACATGGAGAGATGACGAACATGATTGCTGTGAGATTAGTCATTCATTGCTTAACTTAACTTACTTGAATCA...

CDS

Download CDS FASTA

2466 bp · LXL04_004573|LXL04_004573|OH1004|CDS

ATGAATCATTGTATTTTCATAGTTTTCTCACTTCACTTGCTACTCCTTGTGACTACAACCACCAGCCAATTGACAGCAGTTGTAGAAGGAGGAGATGATACTCAAGGTGTTACGAACAAGTGTTTTGATAAGGAGAGACATGCTCTCCTTTTTAAAGCTCCCATTCAAGACCCCTTTGATTCTTTCTCTACATGGAGAGATGACGAACATGATTGCTGTGAGATTAGTCATTCATTGCTTAACTTAACTTACTTGAATCA...

Protein

Download Protein FASTA

821 aa · LXL04_004573|LXL04_004573|OH1004|PROTEIN

MNHCIFIVFSLHLLLLVTTTTSQLTAVVEGGDDTQGVTNKCFDKERHALLFKAPIQDPFDSFSTWRDDEHDCCEISHSLLNLTYLNHLDLSGNSFYGNIPTFIGSLTKLSFLNLGNNNLNGTIHKSIGSMVRLRYLSLSYNSLHGTIPLEFGNLSNLQNLSLSYMGRCRVENIEWLSHLSHLEELRMDGISLAKANHWVDVILSLQKLLDLSLLGCELSEVMHPYSSFRNSTSSIEFLYLSHNSLNSSMYHWLLPLTSNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004573`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004573

Location Chr01:140899186-140901960 (+)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46330`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	No verified direct reference in this release
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0618700`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	Analysis of flagellin perception mediated by flg22 receptor OsFLS2 in rice.2008 · DOI: 10.1094/mpmi-21-12-1635 Rice OsFLS2-Mediated Perception of Bacterial Flagellins Is Evaded by Xanthomonas oryzae pvs. oryzae and oryzicola.2015 · DOI: 10.1016/j.molp.2015.01.012

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004573 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.841

Rank 1 · LXL04_004573 · OH-1004

Endoplasmic reticulum0.108

Rank 2 · LXL04_004573 · OH-1004

Cytoplasm0.059

Rank 3 · LXL04_004573 · OH-1004

Nucleus0.050

Rank 4 · LXL04_004573 · OH-1004

Lysosome / Vacuole0.027

Rank 5 · LXL04_004573 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1477-257 aa

PF13855.13LRR_884-143 aa

PF13855.13LRR_8108-164 aa

PF23598.2LRR_14260-442 aa

PF13855.13LRR_8313-370 aa

PF23598.2LRR_14506-583 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004573	`PF23598.2`	LRR_14	77	257	1.7e-25	90.3
LXL04_004573	`PF13855.13`	LRR_8	84	143	5.8e-24	84.3
LXL04_004573	`PF13855.13`	LRR_8	108	164	5.8e-24	84.3
LXL04_004573	`PF23598.2`	LRR_14	260	442	1.7e-25	90.3
LXL04_004573	`PF13855.13`	LRR_8	313	370	5.8e-24	84.3
LXL04_004573	`PF23598.2`	LRR_14	506	583	1.7e-25	90.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL28`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FLS2	31.527%	Swiss-Prot	moderate database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	30.659%	Swiss-Prot	moderate database homology
`Q0JA29`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase FLS2	30.313%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card