LXL04_004554 | RubberDandelionOmics

Gene overview

LXL04_004554

Reference: OH-1004 Chr: Chr01 Coordinates: 140437779-140439054 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

719 bp · LXL04_004554|LXL04_004554|OH1004|cDNA

ATGGAGAAAGTCATGAACATATTAAAACCAAAACCTAATCCACAACAGCTCTTACGCGATTGGCAACGCCGTCTCCGCCAAGAAACTCGCAACATCGACCGCCAGATTCGTGATATCCAGCGAGAAGAGAAAAACGTCCAGAAAGCAATCCGAGAGGCTGCCAAGAGAAACGATATGGGTTCTGCTAAGTCACTCGCTAAAGAAATTGTGCAATCCAGAAGAACTGTTAACCGCCTCTATGAAAACAAAGCTCAGTTGAA...

CDS

Download CDS FASTA

675 bp · LXL04_004554|LXL04_004554|OH1004|CDS

ATGGAGAAAGTCATGAACATATTAAAACCAAAACCTAATCCACAACAGCTCTTACGCGATTGGCAACGCCGTCTCCGCCAAGAAACTCGCAACATCGACCGCCAGATTCGTGATATCCAGCGAGAAGAGAAAAACGTCCAGAAAGCAATCCGAGAGGCTGCCAAGAGAAACGATATGGGTTCTGCTAAGTCACTCGCTAAAGAAATTGTGCAATCCAGAAGAACTGTTAACCGCCTCTATGAAAACAAAGCTCAGTTGAA...

Protein

Download Protein FASTA

224 aa · LXL04_004554|LXL04_004554|OH1004|PROTEIN

MEKVMNILKPKPNPQQLLRDWQRRLRQETRNIDRQIRDIQREEKNVQKAIREAAKRNDMGSAKSLAKEIVQSRRTVNRLYENKAQLNSISMHLGESVAIARTVGHLSKSAEVMKIVNNLMKAPEMAVTMQEFNKEMTKAGVIEEMVNDAVDSALDSDDIEDEIDEEVDKVLTALAGETAAQLPEAVRKEKLKQPANANQDAEDEGVDDEEELEEIRARLAKVRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004554`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004554

Location Chr01:140437779-140439054 (-)

Description Similar to VPS24-1: Vacuolar protein sorting-associated protein 24 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22950`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release
`At3g45000`	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004554 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0032509 endosome transport via multivesicular body sorting pathway Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0070676 intralumenal vesicle formation Biological Process

GO:0000815 ESCRT III complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0005829 cytosol Cellular Component

GO:0031902 late endosome membrane Cellular Component

KEGG gene cross-reference

ath:AT3G45000

ath:AT5G22950

dre:406621

xtr:548983

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.803

Rank 1 · LXL04_004554 · OH-1004

Nucleus0.256

Rank 2 · LXL04_004554 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_004554 · OH-1004

Mitochondrion0.072

Rank 4 · LXL04_004554 · OH-1004

Endoplasmic reticulum0.054

Rank 5 · LXL04_004554 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03357.27Snf721-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004554	`PF03357.27`	Snf7	21	188	9.9e-34	117.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFB3`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 24 homolog 1	81.223%	Swiss-Prot	strong database homology
`Q9LXH5`	Arabidopsis thaliana	Putative vacuolar protein sorting-associated protein 24 homolog 2	70.352%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card