LXL04_004373 | RubberDandelionOmics

Gene overview

LXL04_004373

Reference: OH-1004 Chr: Chr01 Coordinates: 133909361-133911451 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1200 bp · LXL04_004373|LXL04_004373|OH1004|cDNA

GGAACAGATGACGACCTTCCTCCGCCACATCAGAACAAATTCAGAAGTGGGGGGCCGGGTGCTACTGGAAACGGAAGGACAATGGCTGTGGGCCCCCCGCCACCTAGGATTCAAAATGACATGGAGGCACAAATCCATGTCATCGAACAAGAAGCATACACCTCAGTCCTTCGTGCCTTTAAAGCCCAATCCGATGCCATCACTTGGGAGATGGAAACTTTGATAACAGATCTTAGGAAGGAGCTTAGAGTATCCGATGA...

CDS

Download CDS FASTA

1119 bp · LXL04_004373|LXL04_004373|OH1004|CDS

ATGGCTGTGGGCCCCCCGCCACCTAGGATTCAAAATGACATGGAGGCACAAATCCATGTCATCGAACAAGAAGCATACACCTCAGTCCTTCGTGCCTTTAAAGCCCAATCCGATGCCATCACTTGGGAGATGGAAACTTTGATAACAGATCTTAGGAAGGAGCTTAGAGTATCCGATGAAGAACACAGAATACTCCTCTCAAGAGTAAATGGCGATGACATCATCAAAAGGATAAGGGAATGGAGGAAAAACAACGGGGG...

Protein

Download Protein FASTA

372 aa · LXL04_004373|LXL04_004373|OH1004|PROTEIN

MAVGPPPPRIQNDMEAQIHVIEQEAYTSVLRAFKAQSDAITWEMETLITDLRKELRVSDEEHRILLSRVNGDDIIKRIREWRKNNGGQPALHKKQKTSQSGPSSSLAPPPPAMHHPMPPSSSAMNRGGSGSGLRGKKPQLYGSASFNSRDQGPKYNGNGVDEDKSSDPLIGRKVWTRWPEDSNFYEAVITDFNPLEGRHALVYDTNTPNEAWEWVNLREISPNDIRWKWEDVGVSQRGGRSGPGRRNKNPAARVEATSGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004373`
TK1151 ID	TkA01G165100
OH-1004 ID	LXL04_004373
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 64.539 / OH-1004 24.462 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004373

Location Chr01:133909361-133911451 (-)

Description Similar to EML3: Protein EMSY-LIKE 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13020`	Probably involved in the regulation of chromatin states (Probable).	No verified direct reference in this release
`At2g44440`	Probably involved in the regulation of chromatin states (Probable).	EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123
`At3g12140`	Probably involved in the regulation of chromatin states (Probable).	EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123
`At5g06780`	Probably involved in the regulation of chromatin states (Probable).	EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004373 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009408 response to heat Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0031491 nucleosome binding Molecular Function

KEGG gene cross-reference

ath:AT2G44440

ath:AT3G12140

ath:AT5G06780

ath:AT5G13020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · LXL04_004373 · OH-1004

Cytoplasm0.097

Rank 2 · LXL04_004373 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_004373 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_004373 · OH-1004

Plastid0.010

Rank 5 · LXL04_004373 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03735.21ENT12-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004373	`PF03735.21`	ENT	12	92	6.2e-29	100.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K2F0`	Arabidopsis thaliana	Protein EMSY-LIKE 3	56.267%	Swiss-Prot	strong database homology
`Q08A72`	Arabidopsis thaliana	Protein EMSY-LIKE 4	43.570%	Swiss-Prot	moderate database homology
`Q9C7C4`	Arabidopsis thaliana	Protein EMSY-LIKE 1	48.817%	Swiss-Prot	moderate database homology
`Q9FG29`	Arabidopsis thaliana	Protein EMSY-LIKE 2	44.910%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card