RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_004356
Reference: OH-1004 Chr: Chr01 Coordinates: 133350119-133352770 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2652 bp · LXL04_004356|LXL04_004356|OH1004|cDNA

ATGAGAGGAGCAGATAATACTAATGTTGTTATGAACAAGTGTCTGGATAAAGAGAGACATGCTCTCCTTCATTTTAAAACTCATTTTCAAGACCTCGATGGTTGTCTCTCTACATGGGCAACTGAAGAAGATGAGTGTTGTAAATGGTTTGGAGTCACGTGTGACAATAAAACAGGTCATGTCACACGACTTGAAATCAGTATGTGTGCTATTTTAGGTGAGATCAGTGATTCATTGCTTAACTTAAGCTACTTAACTCA...

CDS

Download CDS FASTA

2652 bp · LXL04_004356|LXL04_004356|OH1004|CDS

ATGAGAGGAGCAGATAATACTAATGTTGTTATGAACAAGTGTCTGGATAAAGAGAGACATGCTCTCCTTCATTTTAAAACTCATTTTCAAGACCTCGATGGTTGTCTCTCTACATGGGCAACTGAAGAAGATGAGTGTTGTAAATGGTTTGGAGTCACGTGTGACAATAAAACAGGTCATGTCACACGACTTGAAATCAGTATGTGTGCTATTTTAGGTGAGATCAGTGATTCATTGCTTAACTTAAGCTACTTAACTCA...

Protein

Download Protein FASTA

883 aa · LXL04_004356|LXL04_004356|OH1004|PROTEIN

MRGADNTNVVMNKCLDKERHALLHFKTHFQDLDGCLSTWATEEDECCKWFGVTCDNKTGHVTRLEISMCAILGEISDSLLNLSYLTHLELSFTYFHGMFPRFIGSLTKLRLLKLAGNSLYGTIPAEFGNLTNLETLVLQDVGWCRVDNLEWLSHLSQLEELVMDGISLAKVNNWVDVVLSLRKLSFLSLNGCDLSQVMYPYSSFSNSSLSIHTLYLENNHLNSSMYHWLFPLTSNKLSDLDLSSNMLDEIPKYLGNLCSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_004356
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_004356
LocationChr01:133350119-133352770 (+)
DescriptionSimilar to EIX2: Receptor-like protein EIX2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g71400 Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197
At5g46330 Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). No verified direct reference in this release
At4g04220 Receptor-like protein 46. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004356 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process
GO:0006898 receptor-mediated endocytosis Biological Process
GO:0007165 signal transduction Biological Process
GO:0010073 meristem maintenance Biological Process
GO:0016045 detection of bacterium Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0052544 defense response by callose deposition in cell wall Biological Process
GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005768 endosome Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G71400
ath:AT4G04220
ath:AT5G46330
sly:543900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.857
Rank 1 · LXL04_004356 · OH-1004
Endoplasmic reticulum0.095
Rank 2 · LXL04_004356 · OH-1004
Cytoplasm0.056
Rank 3 · LXL04_004356 · OH-1004
Nucleus0.044
Rank 4 · LXL04_004356 · OH-1004
Lysosome / Vacuole0.026
Rank 5 · LXL04_004356 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_216-55 aa
PF23598.2LRR_1473-269 aa
PF13855.13LRR_884-139 aa
PF13855.13LRR_8310-347 aa
PF12799.14LRR_4313-351 aa
PF13855.13LRR_8488-522 aa
PF23598.2LRR_14488-568 aa
PF12799.14LRR_4488-526 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_004356PF08263.18LRRNT_216553.3e-1040.8
LXL04_004356PF23598.2LRR_14732691.4e-32113.5
LXL04_004356PF13855.13LRR_8841393.7e-37126.6
LXL04_004356PF13855.13LRR_83103473.7e-37126.6
LXL04_004356PF12799.14LRR_43133518.6e-2586.9
LXL04_004356PF13855.13LRR_84885223.7e-37126.6
LXL04_004356PF23598.2LRR_144885681.4e-32113.5
LXL04_004356PF12799.14LRR_44885268.6e-2586.9
LXL04_004356PF13855.13LRR_86787213.7e-37126.6
LXL04_004356PF23598.2LRR_146807641.4e-32113.5
LXL04_004356PF13855.13LRR_87307693.7e-37126.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C9H7Arabidopsis thalianaReceptor-like protein 1229.010%Swiss-Protweak database homology
Q9FL28Arabidopsis thalianaLRR receptor-like serine/threonine-protein kinase FLS230.144%Swiss-Protmoderate database homology
F4JGB6Arabidopsis thalianaReceptor-like protein 4631.707%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser