LXL04_004306 | RubberDandelionOmics

Gene overview

LXL04_004306

Reference: OH-1004 Chr: Chr01 Coordinates: 131981472-131982543 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

438 bp · LXL04_004306|LXL04_004306|OH1004|cDNA

ATGGGGTTATTACATGGATCCAAAGGATCATTGTCATGCTTAGCCATGATATTGATGTTGGTTTTTGGTTCAACAAAAGGAGACATAAACAAAGATAAAGAGATGTGTGAAAACCAACTTATGGGGCTAGCAGGTTGTCTACCTTATGTGAGCGGTGAAGCAAAGGTTCCAACTAAGGAGTGTTGTAGTGAGCTCAAGATAGTCTTGAACAAGAGCACGGTATGTCTATGCATCATGATCAAGGATTATAATCCTAGCCT...

CDS

Download CDS FASTA

438 bp · LXL04_004306|LXL04_004306|OH1004|CDS

ATGGGGTTATTACATGGATCCAAAGGATCATTGTCATGCTTAGCCATGATATTGATGTTGGTTTTTGGTTCAACAAAAGGAGACATAAACAAAGATAAAGAGATGTGTGAAAACCAACTTATGGGGCTAGCAGGTTGTCTACCTTATGTGAGCGGTGAAGCAAAGGTTCCAACTAAGGAGTGTTGTAGTGAGCTCAAGATAGTCTTGAACAAGAGCACGGTATGTCTATGCATCATGATCAAGGATTATAATCCTAGCCT...

Protein

Download Protein FASTA

145 aa · LXL04_004306|LXL04_004306|OH1004|PROTEIN

MGLLHGSKGSLSCLAMILMLVFGSTKGDINKDKEMCENQLMGLAGCLPYVSGEAKVPTKECCSELKIVLNKSTVCLCIMIKDYNPSLGFKFNDTLAMRLPDSCNMHASLSECPNLLHLQPGSGEAKIFEDHTKKQHHSFTSEETK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004306`
TK1151 ID	TkA01G174140
OH-1004 ID	LXL04_004306
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.552 / OH-1004 96.552 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004306

Location Chr01:131981472-131982543 (+)

Description Similar to YLS3: Protein YLS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44300`	Probable lipid transfer protein.	No verified direct reference in this release
`At2g44290`	Probable lipid transfer protein.	No verified direct reference in this release
`At1g55260`	Lipid transfer protein involved in seed and ovule maturation and development, probably by regulating the fatty acids homeostasis during suberin and sporopollenin biosynthesis or deposition.	Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.2019 · DOI: 10.1111/mpp.12740
`At3g58550`	Probable lipid transfer protein.	No verified direct reference in this release
`At1g03103`	Probable lipid transfer protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004306 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009625 response to insect Biological Process

GO:0010150 leaf senescence Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0080027 response to herbivore Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0008289 lipid binding Molecular Function

KEGG gene cross-reference

ath:AT1G03103

ath:AT1G55260

ath:AT2G44290

ath:AT2G44300

ath:AT3G58550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.415

Rank 1 · LXL04_004306 · OH-1004

Cell membrane0.283

Rank 2 · LXL04_004306 · OH-1004

Endoplasmic reticulum0.161

Rank 3 · LXL04_004306 · OH-1004

Cytoplasm0.138

Rank 4 · LXL04_004306 · OH-1004

Lysosome / Vacuole0.087

Rank 5 · LXL04_004306 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_227-112 aa

PF00234.28Tryp_alpha_amyl36-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004306	`PF14368.12`	LTP_2	27	112	7.7e-17	61.9
LXL04_004306	`PF00234.28`	Tryp_alpha_amyl	36	109	2.5e-10	41.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64865`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 14	46.341%	Swiss-Prot	moderate database homology
`O64864`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 13	42.424%	Swiss-Prot	moderate database homology
`F4I082`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 6	37.589%	Swiss-Prot	moderate database homology
`Q9M2G1`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 22	35.938%	Swiss-Prot	moderate database homology
`F4HZB9`	Arabidopsis thaliana	Non-specific lipid transfer protein GPI-anchored 19	32.979%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card