LXL04_004294 | RubberDandelionOmics

Gene overview

LXL04_004294

Reference: OH-1004 Chr: Chr01 Coordinates: 131835021-131837508 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

942 bp · LXL04_004294|LXL04_004294|OH1004|cDNA

ATGAGCTTCGATCCAGTTATGCAGCGCGTTAATCGCAATGTTGACGAACATATCTCCCAGCTCATGCAGTGCAAACCCTTGTCCGAACAAGAGGTTAGGTCATTATGTGATAAGGCAAAGGAGATCCTGATGAAAGAAAGCAATGTCCAGCCAGTTAAAAGCCCAGTGACAATTTGTGGGGATATTCATGGCCAATTTCACGATCTTGCAGAGCTCTTTAGGATTGGAGGGAAGTGCCCTGATACAAATTACTTATTCAT...

CDS

Download CDS FASTA

942 bp · LXL04_004294|LXL04_004294|OH1004|CDS

ATGAGCTTCGATCCAGTTATGCAGCGCGTTAATCGCAATGTTGACGAACATATCTCCCAGCTCATGCAGTGCAAACCCTTGTCCGAACAAGAGGTTAGGTCATTATGTGATAAGGCAAAGGAGATCCTGATGAAAGAAAGCAATGTCCAGCCAGTTAAAAGCCCAGTGACAATTTGTGGGGATATTCATGGCCAATTTCACGATCTTGCAGAGCTCTTTAGGATTGGAGGGAAGTGCCCTGATACAAATTACTTATTCAT...

Protein

Download Protein FASTA

313 aa · LXL04_004294|LXL04_004294|OH1004|PROTEIN

MSFDPVMQRVNRNVDEHISQLMQCKPLSEQEVRSLCDKAKEILMKESNVQPVKSPVTICGDIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNASVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNSLKLIARAHQLVMEGFNWGHEQKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004294`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004294

Location Chr01:131835021-131837508 (-)

Description Similar to PP2A: Serine/threonine-protein phosphatase PP2A catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g58500`	Functions redundantly with PP2A3, and is involved in establishing auxin gradients, apical-basal axis of polarity and root and shoot apical meristem during embryogenesis.	No verified direct reference in this release
`At2g42500`	Functions redundantly with PP2A4, and is involved in establishing auxin gradients, apical-basal axis of polarity and root and shoot apical meristem during embryogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0805300`	Serine/threonine-protein phosphatase PP2A-2 catalytic subunit.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004294 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0048364 root development Biological Process

GO:0048863 stem cell differentiation Biological Process

GO:0080022 primary root development Biological Process

GO:0000159 protein phosphatase type 2A complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G42500

ath:AT3G58500

dosa:Os03g0805300

nta:107779504

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.730

Rank 1 · LXL04_004294 · OH-1004

Nucleus0.529

Rank 2 · LXL04_004294 · OH-1004

Mitochondrion0.060

Rank 3 · LXL04_004294 · OH-1004

Cell membrane0.053

Rank 4 · LXL04_004294 · OH-1004

Peroxisome0.038

Rank 5 · LXL04_004294 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00149.34Metallophos55-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004294	`PF00149.34`	Metallophos	55	248	1.3e-46	160.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P48578`	Arabidopsis thaliana	Serine/threonine-protein phosphatase PP2A-4 catalytic subunit	95.017%	Swiss-Prot	strong database homology
`Q07100`	Arabidopsis thaliana	Serine/threonine-protein phosphatase PP2A-3 catalytic subunit	94.352%	Swiss-Prot	strong database homology
`Q10BT5`	Oryza sativa subsp. japonica	Serine/threonine-protein phosphatase PP2A-2 catalytic subunit	92.834%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card