LXL04_004281 | RubberDandelionOmics

Gene overview

LXL04_004281

Reference: OH-1004 Chr: Chr01 Coordinates: 131685419-131688990 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2250 bp · LXL04_004281|LXL04_004281|OH1004|cDNA

ATGGAAATTCAGATGGCTAAAGTTAAACGTATCCAAGAATTGGGACTCCAAGAACTATTGAATACTGGGTTATCAGCACATGATGCGAAATCGCTGCAAATCGAGCTTGAAGAAGCCATTCAACGCACCACTAGCTCCAGTCCAGTTGAGTTATGGCGCGACATCACTTCTCGAAGGTTGCTCAGACCATCTTACCCTCATTCTCTTCACCGGCTCATCTACAACGCGGTTTATGCTGATTACGATGCCTCCGTCCATGG...

CDS

Download CDS FASTA

2250 bp · LXL04_004281|LXL04_004281|OH1004|CDS

ATGGAAATTCAGATGGCTAAAGTTAAACGTATCCAAGAATTGGGACTCCAAGAACTATTGAATACTGGGTTATCAGCACATGATGCGAAATCGCTGCAAATCGAGCTTGAAGAAGCCATTCAACGCACCACTAGCTCCAGTCCAGTTGAGTTATGGCGCGACATCACTTCTCGAAGGTTGCTCAGACCATCTTACCCTCATTCTCTTCACCGGCTCATCTACAACGCGGTTTATGCTGATTACGATGCCTCCGTCCATGG...

Protein

Download Protein FASTA

749 aa · LXL04_004281|LXL04_004281|OH1004|PROTEIN

MEIQMAKVKRIQELGLQELLNTGLSAHDAKSLQIELEEAIQRTTSSSPVELWRDITSRRLLRPSYPHSLHRLIYNAVYADYDASVHGPAPYWFPSDVNGTETNLGRLLETHGSKLLGAAYKDPITSFKQFQKFSAYWSIVLEELSIRFHQPPKCILDTSNKSKHNGTWFPDSVLNIAECCLKPNTKHDNGNERVAIVWRDERFDNFEVNKMTLNELRHQVMVVANSLKGLFSKGDPIAIDMPMTVTAVVLYLAIIYSGFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004281`
TK1151 ID	TkA01G174920
OH-1004 ID	LXL04_004281
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.500
Protein coverage (%)	TK1151 99.869 / OH-1004 99.866 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004281

Location Chr01:131685419-131688990 (+)

Description Similar to AAE18: Probable acyl-activating enzyme 18, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55320`	May be involved in the peroxisomal activation of 2,4- dichlorophenoxybutyric acid (2,4-DB), a precursor of active auxins that inhibit root growth.	Identification of two Arabidopsis genes encoding a peroxisomal oxidoreductase-like protein and an acyl-CoA synthetase-like protein that are required for responses to pro-auxins.2009 · DOI: 10.1007/s11103-008-9431-4
`At5g23050`	May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004281 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0009850 auxin metabolic process Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0019427 acetyl-CoA biosynthetic process from acetate Biological Process

GO:0046949 fatty-acyl-CoA biosynthetic process Biological Process

GO:1901696 cannabinoid biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G55320

ath:AT5G23050

stt:t4181

sty:STY4473

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.465

Rank 1 · LXL04_004281 · OH-1004

Cytoplasm0.325

Rank 2 · LXL04_004281 · OH-1004

Nucleus0.143

Rank 3 · LXL04_004281 · OH-1004

Mitochondrion0.108

Rank 4 · LXL04_004281 · OH-1004

Plastid0.078

Rank 5 · LXL04_004281 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27750.1SAM_AAE17_189-79 aa

PF16177.12ACAS_N133-180 aa

PF00501.35AMP-binding192-433 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004281	`PF27750.1`	SAM_AAE17_18	9	79	1.1e-14	55.3
LXL04_004281	`PF16177.12`	ACAS_N	133	180	2.9e-06	27.7
LXL04_004281	`PF00501.35`	AMP-binding	192	433	3.6e-30	105.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84P17`	Arabidopsis thaliana	Probable acyl-activating enzyme 18, peroxisomal	58.745%	Swiss-Prot	strong database homology
`F4KBF3`	Arabidopsis thaliana	Probable acyl-activating enzyme 17, peroxisomal	46.051%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card