LXL04_004263 | RubberDandelionOmics

Gene overview

LXL04_004263

Reference: OH-1004 Chr: Chr01 Coordinates: 131408013-131409358 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · LXL04_004263|LXL04_004263|OH1004|cDNA

ATGGGTTTCCGCAATGGAGCGACCATGGAGAATATCCCAGACGTTCTTTTACCAAACATATTCATCAGGTTACCGGCGAAACAGCTTGCTCAGATGAGGTGCGTCACTAAATCGTGGAATGCAATTTTATCTCAATCCTCATTCATAAAATCCCACCTGAATCGTTCAATCCAAAGCAACAACACCGATGGAATTCTCCTCGCCTTCCCCCACTTTTTTTCTTTCGCCTCCAAACCATTCACAGCACACCCCTCTCGCTC...

CDS

Download CDS FASTA

1251 bp · LXL04_004263|LXL04_004263|OH1004|CDS

ATGGGTTTCCGCAATGGAGCGACCATGGAGAATATCCCAGACGTTCTTTTACCAAACATATTCATCAGGTTACCGGCGAAACAGCTTGCTCAGATGAGGTGCGTCACTAAATCGTGGAATGCAATTTTATCTCAATCCTCATTCATAAAATCCCACCTGAATCGTTCAATCCAAAGCAACAACACCGATGGAATTCTCCTCGCCTTCCCCCACTTTTTTTCTTTCGCCTCCAAACCATTCACAGCACACCCCTCTCGCTC...

Protein

Download Protein FASTA

416 aa · LXL04_004263|LXL04_004263|OH1004|PROTEIN

MGFRNGATMENIPDVLLPNIFIRLPAKQLAQMRCVTKSWNAILSQSSFIKSHLNRSIQSNNTDGILLAFPHFFSFASKPFTAHPSRSPHLEITDFIKLPLNPQSNIARGMVIGCVNGLICFTYGSNHHSEYIRIWNPSLAEAICIWNPSLSALITLPPYYIPSHSIQQYLRFGYDPKTDDYKVVKVTRHIEKQADGITTAIKEWLPVEVYSMRTGSWKYLITQKIPSYVSDLYDSDKLCVDGHEGHLHWVAEINRHWDAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004263`
TK1151 ID	TkA01G176290
OH-1004 ID	LXL04_004263
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004263

Location Chr01:131408013-131409358 (+)

Description Similar to At3g06240: F-box/kelch-repeat protein At3g06240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06240`	F-box/kelch-repeat protein At3g06240.	No verified direct reference in this release
`At4g12560`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	An F-box gene, CPR30, functions as a negative regulator of the defense response in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03995.x
`At3g16210`	Putative F-box protein At3g16210.	No verified direct reference in this release
`At4g22390`	F-box protein At4g22390.	No verified direct reference in this release
`At3g10240`	Putative F-box protein At3g10240.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004263 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G10240

ath:AT3G16210

ath:AT4G12560

ath:AT4G22390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.631

Rank 1 · LXL04_004263 · OH-1004

Nucleus0.395

Rank 2 · LXL04_004263 · OH-1004

Cell membrane0.113

Rank 3 · LXL04_004263 · OH-1004

Endoplasmic reticulum0.079

Rank 4 · LXL04_004263 · OH-1004

Lysosome / Vacuole0.040

Rank 5 · LXL04_004263 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box10-48 aa

PF07734.19FBA_1105-358 aa

PF08268.18FBA_3107-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004263	`PF00646.39`	F-box	10	48	8.3e-07	29.4
LXL04_004263	`PF07734.19`	FBA_1	105	358	4.7e-19	69.2
LXL04_004263	`PF08268.18`	FBA_3	107	333	7e-22	78.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXC7`	Arabidopsis thaliana	F-box/kelch-repeat protein At3g06240	27.072%	Swiss-Prot	weak database homology
`Q9SU30`	Arabidopsis thaliana	F-box protein CPR1	28.571%	Swiss-Prot	weak database homology
`Q9LU24`	Arabidopsis thaliana	Putative F-box protein At3g16210	26.708%	Swiss-Prot	weak database homology
`Q9SUY0`	Arabidopsis thaliana	F-box protein At4g22390	25.369%	Swiss-Prot	weak database homology
`Q9SS35`	Arabidopsis thaliana	Putative F-box protein At3g10240	23.858%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card