LXL04_004188 | RubberDandelionOmics

Gene overview

LXL04_004188

Reference: OH-1004 Chr: Chr01 Coordinates: 128318751-128320227 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

678 bp · LXL04_004188|LXL04_004188|OH1004|cDNA

ATGAGCAATACTAAGCATATCCTTCTCCGATTTCACACAGGATACTCCGAATCCAAGGTATGTAGTTCTATTTTCGATTTCAGTGCTTTGATTCCACAGTTAGTATCTCGGATTTCACAGATCATCTCGGATTTCACACAGGCATTCCGAATTTTGGCATTCAGCAACTTCGATTTCTCACAGGCACTCCGATTTCTCAAGTTACCAGTGAGCAACTCCAATTTTACCAGTGAGCAACTTCATTCGGAAACATTATGCAG...

CDS

Download CDS FASTA

678 bp · LXL04_004188|LXL04_004188|OH1004|CDS

ATGAGCAATACTAAGCATATCCTTCTCCGATTTCACACAGGATACTCCGAATCCAAGGTATGTAGTTCTATTTTCGATTTCAGTGCTTTGATTCCACAGTTAGTATCTCGGATTTCACAGATCATCTCGGATTTCACACAGGCATTCCGAATTTTGGCATTCAGCAACTTCGATTTCTCACAGGCACTCCGATTTCTCAAGTTACCAGTGAGCAACTCCAATTTTACCAGTGAGCAACTTCATTCGGAAACATTATGCAG...

Protein

Download Protein FASTA

225 aa · LXL04_004188|LXL04_004188|OH1004|PROTEIN

MSNTKHILLRFHTGYSESKVCSSIFDFSALIPQLVSRISQIISDFTQAFRILAFSNFDFSQALRFLKLPVSNSNFTSEQLHSETLCRKHEERFQFERKVVYQILHLYSLSIDYGQITMMYHGHHAIQVLLLMKQRFRHYVDLSIGWLHCDPHPLFKAVTFVLPRWLPEWLPWTEMQILPVQWHALGLGYFASIIAPFGGLFASGFKRAFNVKVRNFFSFALYWQR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004188`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004188

Location Chr01:128318751-128320227 (-)

Description Similar to CDS1: Phosphatidate cytidylyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62430`	May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.	No verified direct reference in this release
`At4g22340`	May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.	Two closely related genes of Arabidopsis encode plastidial cytidinediphosphate diacylglycerol synthases essential for photoautotrophic growth.2010 · DOI: 10.1104/pp.110.156422
`At4g26770`	May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004188 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006661 phosphatidylinositol biosynthetic process Biological Process

GO:0007165 signal transduction Biological Process

GO:0007602 phototransduction Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0016024 CDP-diacylglycerol biosynthetic process Biological Process

GO:0080186 developmental vegetative growth Biological Process

GO:0140042 lipid droplet formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

KEGG gene cross-reference

ath:AT1G62430

ath:AT4G22340

ath:AT4G26770

hsa:1040

sot:102597765

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.386

Rank 1 · LXL04_004188 · OH-1004

Nucleus0.347

Rank 2 · LXL04_004188 · OH-1004

Mitochondrion0.170

Rank 3 · LXL04_004188 · OH-1004

Endoplasmic reticulum0.128

Rank 4 · LXL04_004188 · OH-1004

Cell membrane0.083

Rank 5 · LXL04_004188 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01148.26CTP_transf_1169-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004188	`PF01148.26`	CTP_transf_1	169	212	1e-08	36.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04928`	Arabidopsis thaliana	Phosphatidate cytidylyltransferase 1	75.000%	Swiss-Prot	weak database homology
`O49639`	Arabidopsis thaliana	Phosphatidate cytidylyltransferase 2	73.611%	Swiss-Prot	weak database homology
`Q1PE48`	Arabidopsis thaliana	Phosphatidate cytidylyltransferase 3	62.500%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card