LXL04_004156 | RubberDandelionOmics

Gene overview

LXL04_004156

Reference: OH-1004 Chr: Chr01 Coordinates: 126530633-126535518 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

979 bp · LXL04_004156|LXL04_004156|OH1004|cDNA

GGTACACTTGGTAGCGGCGAAGAAATTGCAGTAAAAAAACTGGGACAAACATCACGTCAAGGGCGTCCTCAGTTTGATGCTGAAATTAAAGCAATTGCCAATGTCAAGCATATATGCCTTATATAGGTTCGAAATTTCTATATTCATGTATGTGATCTTATGTTATTCTATGAATACATGCACAACAAGAGCGTGTCTTATCGTCTCGATGGAGGAGGGCGTTGGACTAGCAAACCCGGAAGAGGATCATTTTAGCCGTT...

CDS

Download CDS FASTA

906 bp · LXL04_004156|LXL04_004156|OH1004|CDS

TTGATGCTGAAATTAAAGCAATTGCCAATGTCAAGCATATATGCCTTATATAGGTTCGAAATTTCTATATTCATGTATGTGATCTTATGTTATTCTATGAATACATGCACAACAAGAGCGTGTCTTATCGTCTCGATGGAGGAGGGCGTTGGACTAGCAAACCCGGAAGAGGATCATTTTAGCCGTTGCGAAGGGCTTGCCGTATCTTCATATGGACTCAAATATACATGCCATTCACAAAGATATCAAAATCAAAATAT...

Protein

Download Protein FASTA

301 aa · LXL04_004156|LXL04_004156|OH1004|PROTEIN

MMLKLKQLPMSSIYALYRFEISIFMYVILCYSMNTCTTRACLIVSMEEGVGLANPEEDHFSRCEGLAVSSYGLKYTCHSQRYQNQNMNAKISDFGITRIFSLDETTARSQTFAGTFGYMALEYAFHLWGQGELYRFKDPLMMEDDHVHNELSRILNIKKTKCVLGDVSSNHMPNANRLSNKSEYSGYMAILGTTNDFGIRRWKGLVPQIPKIFFSEFFDHRKASKSSVKVYCSLPVKVTVASRKNQFAGEDDTVAPEKTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004156`
TK1151 ID	TkA01G194800
OH-1004 ID	LXL04_004156
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.300
Protein coverage (%)	TK1151 41.739 / OH-1004 16.279 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004156

Location Chr01:126530633-126535518 (+)

Description Similar to CRK35: Putative cysteine-rich receptor-like protein kinase 35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11530`	Cysteine-rich receptor-like protein kinase 34.	No verified direct reference in this release
`At3g45860`	Cysteine-rich receptor-like protein kinase 4.	No verified direct reference in this release
`At4g23230`	Cysteine-rich receptor-like protein kinase 15.	No verified direct reference in this release
`At4g05200`	Cysteine-rich receptor-like protein kinase 25.	No verified direct reference in this release
`At4g23310`	Putative cysteine-rich receptor-like protein kinase 23.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004156 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0012501 programmed cell death Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0080136 priming of cellular response to stress Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G45860

ath:AT4G05200

ath:AT4G23230

ath:AT4G23310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.415

Rank 1 · LXL04_004156 · OH-1004

Nucleus0.347

Rank 2 · LXL04_004156 · OH-1004

Mitochondrion0.165

Rank 3 · LXL04_004156 · OH-1004

Cell membrane0.130

Rank 4 · LXL04_004156 · OH-1004

Endoplasmic reticulum0.096

Rank 5 · LXL04_004156 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDQ3`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 34	45.455%	Swiss-Prot	weak database homology
`Q9LZU4`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 4	53.333%	Swiss-Prot	weak database homology
`Q8W4G6`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 15	51.163%	Swiss-Prot	weak database homology
`Q9M0X5`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 25	51.163%	Swiss-Prot	weak database homology
`O65482`	Arabidopsis thaliana	Putative cysteine-rich receptor-like protein kinase 23	48.936%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card