LXL04_004066 | RubberDandelionOmics

Gene overview

LXL04_004066

Reference: OH-1004 Chr: Chr01 Coordinates: 123862933-123873783 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

7878 bp · LXL04_004066|LXL04_004066|OH1004|cDNA

CTGCGAACAAAACAAACAATCGATCGGCCgacttcatcttcttcaacttCTTCCTCGCTTCTTCCTCTACGTGGCGACCTCCACACAGTTGTTGGACTATCTCGGCCGACATCCAGCTTCCGTAACAAAGAGTCAGTAACGATGGCGACTCAGTCACATGCTCAGGCGGTTAAGTCTTTAAACAAGGGAGCTGGAAGAAGACGCTTTGTGTTCAAGACATTCTCTCAACGAATTGAAGAAATTGATGTTGATGTTTTTCG...

CDS

Download CDS FASTA

7878 bp · LXL04_004066|LXL04_004066|OH1004|CDS

CTGCGAACAAAACAAACAATCGATCGGCCGACTTCATCTTCTTCAACTTCTTCCTCGCTTCTTCCTCTACGTGGCGACCTCCACACAGTTGTTGGACTATCTCGGCCGACATCCAGCTTCCGTAACAAAGAGTCAGTAACGATGGCGACTCAGTCACATGCTCAGGCGGTTAAGTCTTTAAACAAGGGAGCTGGAAGAAGACGCTTTGTGTTCAAGACATTCTCTCAACGAATTGAAGAAATTGATGTTGATGTTTTTCG...

Protein

Download Protein FASTA

2625 aa · LXL04_004066|LXL04_004066|OH1004|PROTEIN

MRTKQTIDRPTSSSSTSSSLLPLRGDLHTVVGLSRPTSSFRNKESVTMATQSHAQAVKSLNKGAGRRRFVFKTFSQRIEEIDVDVFRSLDPLKPEPSAGSSFFRDCLVEWRELNTAEDFISFYEEMLPVVQTLPQIILQKEFILKQLLSRLDMKGRLSLEPILRLIAALSRDILEDFIPFLQRVADSMALLLSSGADRESDIIEQIFTSWSCIMMYLQKYLMKDVVHVLKVTKKLRFYPKDYIQEFMAESVSFLLRNAPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004066`
TK1151 ID	TkA01G207920
OH-1004 ID	LXL04_004066
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 99.765 / OH-1004 48.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_004066`
Location	Chr01:123862933-123873783 (-)
Description	Similar to utp20: U3 small nucleolar RNA-associated protein 20 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004066` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0030686 90S preribosome Cellular Component
KEGG gene cross-reference	hsa:27340 sce:YBL004W spo:2540842 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.669

Rank 1 · LXL04_004066 · OH-1004

Cytoplasm0.270

Rank 2 · LXL04_004066 · OH-1004

Golgi apparatus0.064

Rank 3 · LXL04_004066 · OH-1004

Cell membrane0.055

Rank 4 · LXL04_004066 · OH-1004

Endoplasmic reticulum0.048

Rank 5 · LXL04_004066 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07539.19UTP20_N905-1529 aa

PF20416.5UTP201711-1927 aa

PF23099.2UTP20_C2540-2616 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004066	`PF07539.19`	UTP20_N	905	1529	2.5e-109	367.1
LXL04_004066	`PF20416.5`	UTP20	1711	1927	6.6e-63	212.8
LXL04_004066	`PF23099.2`	UTP20_C	2540	2616	2.6e-09	37.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card