Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2937 bp · LXL04_003684|LXL04_003684|OH1004|cDNA
ATGGCAATGGCGATCAAGCTTTCCCTCCTCTTCCTCGTCTTCTCATGCTCTTTAATCTCTACCTTATCACTATTCGAAGATCAAGTTGGCTTCATGGACTGGCATCAAAGGTACATAGGGAAAGTAAAGCATGCAGTGTTTCACACGCAAAAGGCAGGCCGGAAACGTGTTGTGGTGTCGACTGAAGAGAATGTCATTGCCTCCCTTGACCTTCGTCGAGGCGAGATATTTTGGAGACATGTTCTTGGATCCAATGATGT...
2937 bp · LXL04_003684|LXL04_003684|OH1004|CDS
ATGGCAATGGCGATCAAGCTTTCCCTCCTCTTCCTCGTCTTCTCATGCTCTTTAATCTCTACCTTATCACTATTCGAAGATCAAGTTGGCTTCATGGACTGGCATCAAAGGTACATAGGGAAAGTAAAGCATGCAGTGTTTCACACGCAAAAGGCAGGCCGGAAACGTGTTGTGGTGTCGACTGAAGAGAATGTCATTGCCTCCCTTGACCTTCGTCGAGGCGAGATATTTTGGAGACATGTTCTTGGATCCAATGATGT...
Protein
Download Protein FASTA978 aa · LXL04_003684|LXL04_003684|OH1004|PROTEIN
MAMAIKLSLLFLVFSCSLISTLSLFEDQVGFMDWHQRYIGKVKHAVFHTQKAGRKRVVVSTEENVIASLDLRRGEIFWRHVLGSNDVIDKIDIALGKYVITLSSEGSILRAWNLPDGQMVWESFLSGSKSSKALLTIPANLKLDLDSPIFVYGGTCLYAISSIDGEILWKKDFIDEGIDVHQLILPEGSNVIHAVGVSDPSEFNTYEIDVKNGGVLKHSTESFPGGIFGNILPVSSDKYVALDATRSMLTLISTTDGELN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_003684 |
|---|---|
| TK1151 ID | TkA01G296480 |
| OH-1004 ID | LXL04_003684 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_003684 |
|---|---|
| Location | Chr01:94357155-94361807 (-) |
| Description | Similar to EMC1: ER membrane protein complex subunit 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0034975 protein folding in endoplasmic reticulum Biological Process GO:0045050 protein insertion into ER membrane by stop-transfer membrane-anchor sequence Biological Process GO:0071816 tail-anchored membrane protein insertion into ER membrane Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0072546 EMC complex Cellular Component GO:0032977 membrane insertase activity Molecular Function |
| KEGG gene cross-reference | gga:419470 hsa:23065 mmu:230866 pon:100173298 xla:431852 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25293.2Beta-prop_EMC1_N24-412 aaPF13570.14Beta-prop_ACSF434-300 aaPF07774.20EMC1_C486-935 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_003684 | PF25293.2 | Beta-prop_EMC1_N | 24 | 412 | 6.5e-133 | 444.6 |
| LXL04_003684 | PF13570.14 | Beta-prop_ACSF4 | 34 | 300 | 4.2e-08 | 33.7 |
| LXL04_003684 | PF07774.20 | EMC1_C | 486 | 935 | 3.2e-117 | 393.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.