LXL04_003659 | RubberDandelionOmics

Gene overview

LXL04_003659

Reference: OH-1004 Chr: Chr01 Coordinates: 92736406-92739682 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2184 bp · LXL04_003659|LXL04_003659|OH1004|cDNA

ATGGGTAGCTGCAGATGTATTGGATTATCCTCAACGAAACCATTTTGCCGTAGGATCTTAATTACTTATAAAAGATCTTCTCTGTTTGGGTTTCAAATCCCTATATCCAATCACTCGGCTGTGATCAATTTGACGAAATCTCGATCTAATTTACATGGTTCCAGAGGAACTCATACTTGTAAAAGTAAGCTTCTAGGGTTTAGCGAAGGTGCGACTGATCCAAACTTACGCTTTAGAGACGTAAGTGATTCGAATCAGAA...

CDS

Download CDS FASTA

2184 bp · LXL04_003659|LXL04_003659|OH1004|CDS

ATGGGTAGCTGCAGATGTATTGGATTATCCTCAACGAAACCATTTTGCCGTAGGATCTTAATTACTTATAAAAGATCTTCTCTGTTTGGGTTTCAAATCCCTATATCCAATCACTCGGCTGTGATCAATTTGACGAAATCTCGATCTAATTTACATGGTTCCAGAGGAACTCATACTTGTAAAAGTAAGCTTCTAGGGTTTAGCGAAGGTGCGACTGATCCAAACTTACGCTTTAGAGACGTAAGTGATTCGAATCAGAA...

Protein

Download Protein FASTA

727 aa · LXL04_003659|LXL04_003659|OH1004|PROTEIN

MGSCRCIGLSSTKPFCRRILITYKRSSLFGFQIPISNHSAVINLTKSRSNLHGSRGTHTCKSKLLGFSEGATDPNLRFRDVSDSNQKGFYGSASKWERQVQPNVLFNGCPVGGIDRRFSRLVSKVASDYRNHSTSVESHVNDTSWEKIYIKGRLNVKPLVIEKEESEEKVVDKDYYSDSSVNTKSSETVLGEERKESEIEKEAWRLLRDSIVNYCGSPVGTVAATDPADKLPLNYDQVFIRDFVPSALAFLLNGEGEIVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003659`
TK1151 ID	TkA01G305660
OH-1004 ID	LXL04_003659
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.434 / OH-1004 24.622 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003659

Location Chr01:92736406-92739682 (-)

Description Similar to INVA: Alkaline/neutral invertase A, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56560`	Mitochondrial invertase that cleaves sucrose into glucose and fructose and is involved in the regulation of multiple tissue development and floral transition.	Exploring the neutral invertase-oxidative stress defence connection in Arabidopsis thaliana.2011 · DOI: 10.1093/jxb/err069
`At3g06500`	Mitochondrial invertase that cleaves sucrose into glucose and fructose and is involved in the regulation of aerial tissue development and floral transition.	A mitochondrial alkaline/neutral invertase isoform (A/N-InvC) functions in developmental energy-demanding processes in Arabidopsis.2013 · DOI: 10.1007/s00425-012-1794-8
`At3g05820`	Chloroplastic invertase that cleaves sucrose into glucose and fructose and may participate in the carbon flux between the cytosol and plastids in leaves.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0314800`	Mitochondrial invertase that cleaves sucrose into glucose and fructose.	Genes for alkaline/neutral invertase in rice: alkaline/neutral invertases are located in plant mitochondria and also in plastids.2007 · DOI: 10.1007/s00425-006-0430-x
`Os02g0529400`	Mitochondrial invertase that cleaves sucrose into glucose and fructose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003659 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005987 sucrose catabolic process Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0048364 root development Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004575 sucrose alpha-glucosidase activity Molecular Function

GO:0033926 endo-alpha-N-acetylgalactosaminidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G56560

ath:AT3G05820

ath:AT3G06500

dosa:Os02g0529400

dosa:Os03g0314800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.592

Rank 1 · LXL04_003659 · OH-1004

Mitochondrion0.273

Rank 2 · LXL04_003659 · OH-1004

Cytoplasm0.082

Rank 3 · LXL04_003659 · OH-1004

Nucleus0.079

Rank 4 · LXL04_003659 · OH-1004

Cell membrane0.035

Rank 5 · LXL04_003659 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12899.14Glyco_hydro_100203-275 aa

PF12899.14Glyco_hydro_100311-685 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003659	`PF12899.14`	Glyco_hydro_100	203	275	8.6e-218	724.1
LXL04_003659	`PF12899.14`	Glyco_hydro_100	311	685	8.6e-218	724.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXA8`	Arabidopsis thaliana	Alkaline/neutral invertase A, mitochondrial	69.331%	Swiss-Prot	strong database homology
`B9DFA8`	Arabidopsis thaliana	Alkaline/neutral invertase C, mitochondrial	61.918%	Swiss-Prot	strong database homology
`Q84JL5`	Arabidopsis thaliana	Probable alkaline/neutral invertase A, chloroplastic	69.805%	Swiss-Prot	strong database homology
`Q10MC0`	Oryza sativa subsp. japonica	Neutral/alkaline invertase 1, mitochondrial	75.138%	Swiss-Prot	strong database homology
`Q6H6N5`	Oryza sativa subsp. japonica	Neutral/alkaline invertase 3, chloroplastic	67.424%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card