LXL04_003653 | RubberDandelionOmics

Gene overview

LXL04_003653

Reference: OH-1004 Chr: Chr01 Coordinates: 92108988-92112293 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · LXL04_003653|LXL04_003653|OH1004|cDNA

ATGGTGAACAAAGGATCCGATGAAGATCACACAAATGATGTTATTGACGAACACGAATCCGATGGAGTCGACAATCAAATTCAGGATCCACAACCAAATGATAATCAAGGTGAATCCGATGAAGAGCACACAACCAATCTCGGGATCCAAAGCCAAATGAAAATCAAGATCGATTTGATTTGGATTTCAAAATTGATTTGGATTTTCAGTTCTTATGTGCTCTTATGTGCTCTTCTTATGTTCTTATGTGCTCTTCTTAT...

CDS

Download CDS FASTA

1059 bp · LXL04_003653|LXL04_003653|OH1004|CDS

ATGGTGAACAAAGGATCCGATGAAGATCACACAAATGATGTTATTGACGAACACGAATCCGATGGAGTCGACAATCAAATTCAGGATCCACAACCAAATGATAATCAAGGTGAATCCGATGAAGAGCACACAACCAATCTCGGGATCCAAAGCCAAATGAAAATCAAGATCGATTTGATTTGGATTTCAAAATTGATTTGGATTTTCAGTTCTTATGTGCTCTTATGTGCTCTTCTTATGTTCTTATGTGCTCTTCTTAT...

Protein

Download Protein FASTA

352 aa · LXL04_003653|LXL04_003653|OH1004|PROTEIN

MVNKGSDEDHTNDVIDEHESDGVDNQIQDPQPNDNQGESDEEHTTNLGIQSQMKIKIDLIWISKLIWIFSSYVLLCALLMFLCALLMFLCSYVRGVRLRRDRIIVILEQKIFVYNFTDLKLLQQIETFANPKGLCEVSQASGNFVLVCLELRKGQVRVEHYASKQTKFILAHDSRMPASLCHRMGICLPQPATRELLFVSSILTTGHCCTRYVLISSTLFTIHEFLVRRGADRAEIHSLAFSPTAEWLAVSSDKVTILVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003653`
TK1151 ID	TkA01G308400
OH-1004 ID	LXL04_003653
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.800 / OH-1004 34.375 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003653

Location Chr01:92108988-92112293 (-)

Description Similar to ATG18A: Autophagy-related protein 18a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62770`	May act as a PI(3,5)P₂ regulatory-complex component in phosphatidylinositol 3,5-bisphosphate synthesis and turnover.	Autophagy differentially controls plant basal immunity to biotrophic and necrotrophic pathogens.2011 · DOI: 10.1111/j.1365-313x.2011.04546.x A critical role of autophagy in plant resistance to necrotrophic fungal pathogens.2011 · DOI: 10.1111/j.1365-313x.2011.04553.x The autophagy gene, ATG18a, plays a negative role in powdery mildew resistance and mildew-induced cell death in Arabidopsis.2011 · DOI: 10.4161/psb.6.9.16967
`At3g56440`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At2g40810`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At5g05150`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003653 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000425 pexophagy Biological Process

GO:0006914 autophagy Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0015031 protein transport Biological Process

KEGG gene cross-reference

ath:AT2G40810

ath:AT3G56440

ath:AT3G62770

ath:AT5G05150

xtr:493546

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.365

Rank 1 · LXL04_003653 · OH-1004

Nucleus0.322

Rank 2 · LXL04_003653 · OH-1004

Endoplasmic reticulum0.252

Rank 3 · LXL04_003653 · OH-1004

Golgi apparatus0.130

Rank 4 · LXL04_003653 · OH-1004

Cell membrane0.120

Rank 5 · LXL04_003653 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21032.3PROPPIN91-268 aa

PF21034.4BCAS3_WD40215-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003653	`PF21032.3`	PROPPIN	91	268	1.2e-10	41.9
LXL04_003653	`PF21034.4`	BCAS3_WD40	215	264	1.4e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VB2`	Arabidopsis thaliana	Autophagy-related protein 18a	58.303%	Swiss-Prot	strong database homology
`Q0WPK3`	Arabidopsis thaliana	Autophagy-related protein 18d	43.972%	Swiss-Prot	moderate database homology
`Q8GYD7`	Arabidopsis thaliana	Autophagy-related protein 18c	42.215%	Swiss-Prot	moderate database homology
`Q9FHK8`	Arabidopsis thaliana	Autophagy-related protein 18e	37.500%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card