LXL04_003575 | RubberDandelionOmics

Gene overview

LXL04_003575

Reference: OH-1004 Chr: Chr01 Coordinates: 86437435-86440808 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1674 bp · LXL04_003575|LXL04_003575|OH1004|cDNA

ATGGCATCTATGATGCAACCTCAGATCATACTGCTTAAAGAAGGTACAGACACTTCGCAAGGGAAACCGCAGTTGATAAGCAACATTAATGCGTGTATGGCGGTGGCTGATGTCGTCCGTACAACCCTAGGACCGAGAGGTATGGATAAGCTGATCCATGATGATAAGGGTAACACCACTATTTCTAACGATGGCGCCACCATCATGAAGCTTCTTGACATCGTTCACCCTGCCGCTAAGATCCTTGTTGATATAGCCAA...

CDS

Download CDS FASTA

1674 bp · LXL04_003575|LXL04_003575|OH1004|CDS

ATGGCATCTATGATGCAACCTCAGATCATACTGCTTAAAGAAGGTACAGACACTTCGCAAGGGAAACCGCAGTTGATAAGCAACATTAATGCGTGTATGGCGGTGGCTGATGTCGTCCGTACAACCCTAGGACCGAGAGGTATGGATAAGCTGATCCATGATGATAAGGGTAACACCACTATTTCTAACGATGGCGCCACCATCATGAAGCTTCTTGACATCGTTCACCCTGCCGCTAAGATCCTTGTTGATATAGCCAA...

Protein

Download Protein FASTA

557 aa · LXL04_003575|LXL04_003575|OH1004|PROTEIN

MASMMQPQIILLKEGTDTSQGKPQLISNINACMAVADVVRTTLGPRGMDKLIHDDKGNTTISNDGATIMKLLDIVHPAAKILVDIAKSQDSEVGDGTTTVVLLAGEFLKEAKPFIEDGVHPQNLIRSYRTASFMAIEKIKELAVSIEGKSLDEKRSLLAKCAATTLSSKLIGGEKDFFAKMVVDAVIAIGNDDRLNMIGIKKVPGGTMRDSFLVNGVAFKKTFSYAGFEQQPKKFLNPKILLLNIELELKSEKENAEIRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003575`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003575

Location Chr01:86437435-86440808 (-)

Description Similar to CCT7: T-complex protein 1 subunit eta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11830`	Molecular chaperone; assists the folding of proteins upon ATP hydrolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003575 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0007339 binding of sperm to zona pellucida Biological Process

GO:0032212 positive regulation of telomere maintenance via telomerase Biological Process

GO:0050821 protein stabilization Biological Process

GO:0002199 zona pellucida receptor complex Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005832 chaperonin-containing T-complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0044297 cell body Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT3G11830

bta:514355

mmu:12468

pon:100173801

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.837

Rank 1 · LXL04_003575 · OH-1004

Nucleus0.302

Rank 2 · LXL04_003575 · OH-1004

Mitochondrion0.053

Rank 3 · LXL04_003575 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_003575 · OH-1004

Cell membrane0.036

Rank 5 · LXL04_003575 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00118.30Cpn60_TCP135-528 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003575	`PF00118.30`	Cpn60_TCP1	35	528	2.2e-161	538.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SF16`	Arabidopsis thaliana	T-complex protein 1 subunit eta	90.875%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card