Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1516 bp · LXL04_003574|LXL04_003574|OH1004|cDNA
ATGGCGACATTTTTCTCTCCTTCCTGCTCTCCGCCATTATCGTTCAGTGATAATCGCAAGGCGTTAGGATTTCCAATTTCATATTACCAACGTCGTCGTCAgcaccatcatcatcattacACCAAGACATCAATTCGACTACCCCCAAGTACACCATTAGGTTTAATCAAATTCAGATTCTTCTCCTCTCAGGGGCAGCAGCAGTCTTCCGAACAAAAACCAAAACTCGAAGAAGACGACGTAGAATATGAGTTCGAGAG...
1269 bp · LXL04_003574|LXL04_003574|OH1004|CDS
ATGAGTTCGAGAGGCTCTTTTCTAACCTTAATCGAGCTACCCTCAAAAGGGAACCTGATTGTTATCCACTGCTCTCCAGGAAGCGTCACTAGTTCTGTTCTTCTGGTTGCTGGCACCACTGTAGGTGCAGGAATTCTTGCTATTCCTGCAGTGACTCAGGAAGCTGGATTTTTGGCAGCCGGGATCACTTGCATTCTGTGTTGGATTTATATGGTTGTAACTGGTCTGCTAATTGCTGAAGTAAATGTAAAGACAATGTG...
Protein
Download Protein FASTA422 aa · LXL04_003574|LXL04_003574|OH1004|PROTEIN
MSSRGSFLTLIELPSKGNLIVIHCSPGSVTSSVLLVAGTTVGAGILAIPAVTQEAGFLAAGITCILCWIYMVVTGLLIAEVNVKTMCELGSGGVSLVSMATRTLGTIGVQIVCWSYIFIHYALLVAYVARSSDILTNILGIPVWECASLFSILLGSLCYFGSQRLIGVVNGVLVSGIIISFSALVAVASGDLQWDGLLKANLQAIPSSIPIIALSFVYQNVVPVLCTNLEGDLSKIRSSIVLGTAIPLGLFLIWNAVILG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_003574 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_003574 |
|---|---|
| Location | Chr01:86429983-86433768 (+) |
| Description | Similar to tyrP: Tyrosine-specific transport protein |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0003333 amino acid transmembrane transport Biological Process GO:0005886 plasma membrane Cellular Component GO:0015173 aromatic amino acid transmembrane transporter activity Molecular Function GO:0015293 symporter activity Molecular Function GO:0022857 transmembrane transporter activity Molecular Function |
| KEGG gene cross-reference | ecj:JW1895 eco:b1907 ecoc:C3026_10825 hin:HI_0287 hin:HI_0477 hin:HI_0528 sfl:SF1953 sfx:S2046 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03222.20Trp_Tyr_perm28-401 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_003574 | PF03222.20 | Trp_Tyr_perm | 28 | 401 | 6.8e-71 | 240.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.