LXL04_003560 | RubberDandelionOmics

Gene overview

LXL04_003560

Reference: OH-1004 Chr: Chr01 Coordinates: 85808897-85809781 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · LXL04_003560|LXL04_003560|OH1004|cDNA

ATGGGTGATCAcacaaaaaacaaaatttatcCGGATGCATATGGCAATGTAAAGAGTGGTGCAACAACGGCTCAAGCATCATCAAGTCTCGGCAACCACCTACGACCACCATTGTTGCCACCACAACAACCACAAACAAAAGACATGCACACACATACACAAACGATGGGAGATCACAAAATAAACAAAATTCATTCCATGGCAGATGGAACTTCCAAGAGTGTCGCACAGCCTCTCGGCCACCACCTAAGACCACCTTT...

CDS

Download CDS FASTA

885 bp · LXL04_003560|LXL04_003560|OH1004|CDS

ATGGGTGATCACACAAAAAACAAAATTTATCCGGATGCATATGGCAATGTAAAGAGTGGTGCAACAACGGCTCAAGCATCATCAAGTCTCGGCAACCACCTACGACCACCATTGTTGCCACCACAACAACCACAAACAAAAGACATGCACACACATACACAAACGATGGGAGATCACAAAATAAACAAAATTCATTCCATGGCAGATGGAACTTCCAAGAGTGTCGCACAGCCTCTCGGCCACCACCTAAGACCACCTTT...

Protein

Download Protein FASTA

294 aa · LXL04_003560|LXL04_003560|OH1004|PROTEIN

MGDHTKNKIYPDAYGNVKSGATTAQASSSLGNHLRPPLLPPQQPQTKDMHTHTQTMGDHKINKIHSMADGTSKSVAQPLGHHLRPPLPIPSPPPPRTKKNSRSSLCKCICWSLCILITLLIILAAIIGILYLVFKPKIPNYSVDRLTISQLTVNLDLSLYARFNIQITATNPNKKIGIFYQKGSHLSVWYMNTNLCQGSLPVFYQGHQNKTVLNVALSGQNQYGRTLLAALQEQQQTGRIPLDLKVDVPVKIKLGKLKLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003560`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003560

Location Chr01:85808897-85809781 (+)

Description Similar to NHL6: NDR1/HIN1-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65690`	Plays an important role in the abiotic stresses-induced abscisic acid (ABA) signaling and biosynthesis.	Overexpression of the NDR1/HIN1-Like Gene NHL6 Modifies Seed Germination in Response to Abscisic Acid and Abiotic Stresses in Arabidopsis.2016 · DOI: 10.1371/journal.pone.0148572
`At2g27080`	Required for plant immunity against the bacterial pathogen Pseudomonas syringae pv. tomato DC3000 (Pst DC3000).	Pseudomonas syringae Effector Avirulence Protein E Localizes to the Host Plasma Membrane and Down-Regulates the Expression of the NONRACE-SPECIFIC DISEASE RESISTANCE1/HARPIN-INDUCED1-LIKE13 Gene Required for Antibacterial Immunity in Arabidopsis.2015 · DOI: 10.1104/pp.15.00547
`At3g11650`	May play a role in plant immunity.	No verified direct reference in this release
`At2g35980`	May play a role in plant immunity.	No verified direct reference in this release
`At5g53730`	Involved in the regulation of sugar, amino acid and some primary metabolite export from companion cells (CCs) to sieve elements (SEs) in phloem.	Increased expression of a phloem membrane protein encoded by NHL26 alters phloem export and sugar partitioning in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111849

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003560 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010116 positive regulation of abscisic acid biosynthetic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051607 defense response to virus Biological Process

GO:0051707 response to other organism Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0110126 phloem loading Biological Process

GO:1902074 response to salt Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G65690

ath:AT2G27080

ath:AT2G35980

ath:AT3G11650

ath:AT5G53730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.731

Rank 1 · LXL04_003560 · OH-1004

Cytoplasm0.114

Rank 2 · LXL04_003560 · OH-1004

Endoplasmic reticulum0.097

Rank 3 · LXL04_003560 · OH-1004

Extracellular0.091

Rank 4 · LXL04_003560 · OH-1004

Lysosome / Vacuole0.068

Rank 5 · LXL04_003560 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03168.20LEA_2167-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003560	`PF03168.20`	LEA_2	167	264	1e-10	42.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LD98`	Arabidopsis thaliana	NDR1/HIN1-like protein 6	51.415%	Swiss-Prot	strong database homology
`Q9ZVD2`	Arabidopsis thaliana	NDR1/HIN1-like protein 13	32.161%	Swiss-Prot	moderate database homology
`Q9SRN1`	Arabidopsis thaliana	NDR1/HIN1-like protein 2	27.041%	Swiss-Prot	weak database homology
`Q9SJ52`	Arabidopsis thaliana	NDR1/HIN1-like protein 10	26.154%	Swiss-Prot	weak database homology
`Q9FI03`	Arabidopsis thaliana	NDR1/HIN1-like protein 26	25.581%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card