LXL04_003555 | RubberDandelionOmics

Gene overview

LXL04_003555

Reference: OH-1004 Chr: Chr01 Coordinates: 85466975-85473704 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2619 bp · LXL04_003555|LXL04_003555|OH1004|cDNA

ATGTCTGCTTCATTGCCGGCGTTCGAGCATCCCCGAATTGGTGCTACAAACACGGTCTTTAAAAGCGGGCCGTTGTTCATATCTTCAAAAGGGTTAGGTTGGAAGTCATGGAAGAAGCGCTGGTTTATTCTCACACGCACTTCTTTAGTGTTCTTTAAAAATGACCCCAGTGCGATTCCTCAGAGAGGAGGTGGCGAAGTAAATCTCACTTTGGGGGGGATTGACTTGAACAATTCCGGAAGTGTTGTTGTTAGAGAGGA...

CDS

Download CDS FASTA

2619 bp · LXL04_003555|LXL04_003555|OH1004|CDS

ATGTCTGCTTCATTGCCGGCGTTCGAGCATCCCCGAATTGGTGCTACAAACACGGTCTTTAAAAGCGGGCCGTTGTTCATATCTTCAAAAGGGTTAGGTTGGAAGTCATGGAAGAAGCGCTGGTTTATTCTCACACGCACTTCTTTAGTGTTCTTTAAAAATGACCCCAGTGCGATTCCTCAGAGAGGAGGTGGCGAAGTAAATCTCACTTTGGGGGGGATTGACTTGAACAATTCCGGAAGTGTTGTTGTTAGAGAGGA...

Protein

Download Protein FASTA

872 aa · LXL04_003555|LXL04_003555|OH1004|PROTEIN

MSASLPAFEHPRIGATNTVFKSGPLFISSKGLGWKSWKKRWFILTRTSLVFFKNDPSAIPQRGGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSEDLFEWKTALEHALAQAPSAALVMGHNGIFRNDTTSDSIEGPFHQWRDKRPIKSLVVGRPILLALEDIDGGPSFLEKALRFLEKHGTKVEGILRQAADVEEVDRRVQDYETGKTEFGSDEDAHVVGDCVKHVLRELPSSPVPASCCTAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003555`
TK1151 ID	TkA01G322750
OH-1004 ID	LXL04_003555
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003555

Location Chr01:85466975-85473704 (-)

Description Similar to ROPGAP7: Rho GTPase-activating protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19390`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At5g12150`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At4g24580`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	A tip-localized RhoGAP controls cell polarity by globally inhibiting Rho GTPase at the cell apex.2008 · DOI: 10.1016/j.cub.2008.11.057

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003555 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0007266 Rho protein signal transduction Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009865 pollen tube adhesion Biological Process

GO:0009920 cell plate formation involved in plant-type cell wall biogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035021 negative regulation of Rac protein signal transduction Biological Process

GO:0035024 negative regulation of Rho protein signal transduction Biological Process

GO:0043547 positive regulation of GTPase activity Biological Process

GO:0048868 pollen tube development Biological Process

KEGG gene cross-reference

ath:AT4G24580

ath:AT5G12150

ath:AT5G19390

hsa:83478

xla:414634

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.513

Rank 1 · LXL04_003555 · OH-1004

Cell membrane0.378

Rank 2 · LXL04_003555 · OH-1004

Nucleus0.289

Rank 3 · LXL04_003555 · OH-1004

Golgi apparatus0.066

Rank 4 · LXL04_003555 · OH-1004

Lysosome / Vacuole0.048

Rank 5 · LXL04_003555 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00169.36PH20-125 aa

PF00620.33RhoGAP183-327 aa

PF14389.12Lzipper-MIP1624-703 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003555	`PF00169.36`	PH	20	125	8.6e-12	46.2
LXL04_003555	`PF00620.33`	RhoGAP	183	327	1.1e-31	110.4
LXL04_003555	`PF14389.12`	Lzipper-MIP1	624	703	4e-21	75.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWQ4`	Arabidopsis thaliana	Rho GTPase-activating protein 7	66.517%	Swiss-Prot	strong database homology
`Q9FMP8`	Arabidopsis thaliana	Rho GTPase-activating protein 6	62.877%	Swiss-Prot	strong database homology
`F4JQZ3`	Arabidopsis thaliana	Rho GTPase-activating protein REN1	49.296%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card