LXL04_003393 | RubberDandelionOmics

Gene overview

LXL04_003393

Reference: OH-1004 Chr: Chr01 Coordinates: 77432538-77435720 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2793 bp · LXL04_003393|LXL04_003393|OH1004|cDNA

ATGAAATCCATTGttgttcttcatctttttctgTGTCTTCTCCTCCTGTTTTCACATCTAAAATCCGTTTCTTCATGGAAAAAAGAAGAATTCAGAAACTGTGATCAAACCCCTTTCTGCAAAAGAGCTAGATCAAGAAAACCCCAACACTGTAAACTCATTGCCACCGATGTAGCAATCGCAAATGGAGATCTAACTGCCAAACTCATAACCCCTAAGAATTTTCAAGAAAACGCAGATGAAGATTCATCAGAAATCGC...

CDS

Download CDS FASTA

2793 bp · LXL04_003393|LXL04_003393|OH1004|CDS

ATGAAATCCATTGTTGTTCTTCATCTTTTTCTGTGTCTTCTCCTCCTGTTTTCACATCTAAAATCCGTTTCTTCATGGAAAAAAGAAGAATTCAGAAACTGTGATCAAACCCCTTTCTGCAAAAGAGCTAGATCAAGAAAACCCCAACACTGTAAACTCATTGCCACCGATGTAGCAATCGCAAATGGAGATCTAACTGCCAAACTCATAACCCCTAAGAATTTTCAAGAAAACGCAGATGAAGATTCATCAGAAATCGC...

Protein

Download Protein FASTA

930 aa · LXL04_003393|LXL04_003393|OH1004|PROTEIN

MKSIVVLHLFLCLLLLFSHLKSVSSWKKEEFRNCDQTPFCKRARSRKPQHCKLIATDVAIANGDLTAKLITPKNFQENADEDSSEIASKPLILSLSVYQNGILRLKIDEDPSQNPPKKRFEVPDVVLPEFESKKLWLQRHTKEVIKGDSADSFVVYLFDGYEAVLRSDPLEVFVREQGSGNRVLSFNSYGLFDFEQLRVKKEGDDWEERFRSHTDSRPYGPQSISFDISFHGADFVYGIPEHATTLSLKPTNGPGIEQSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003393`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003393

Location Chr01:77432538-77435720 (+)

Description Similar to PSL5: Probable glucan 1,3-alpha-glucosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63840`	Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins (By similarity).	The cellulose-deficient Arabidopsis mutant rsw3 is defective in a gene encoding a putative glucosidase II, an enzyme processing N-glycans during ER quality control.2002 · DOI: 10.1046/j.1365-313x.2002.01483.x Uncoupling of sustained MAMP receptor signaling from early outputs in an Arabidopsis endoplasmic reticulum glucosidase II allele.2009 · DOI: 10.1073/pnas.0907711106

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0216600`	Cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003393 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006491 N-glycan processing Biological Process

GO:0006952 defense response Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0050830 defense response to Gram-positive bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT5G63840

ddi:DDB_G0269154

dosa:Os03g0216600

mmu:14376

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.740

Rank 1 · LXL04_003393 · OH-1004

Cytoplasm0.131

Rank 2 · LXL04_003393 · OH-1004

Lysosome / Vacuole0.104

Rank 3 · LXL04_003393 · OH-1004

Golgi apparatus0.083

Rank 4 · LXL04_003393 · OH-1004

Extracellular0.052

Rank 5 · LXL04_003393 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13802.13Gal_mutarotas_293-310 aa

PF01055.33Glyco_hydro_31_2nd367-694 aa

PF21365.4Glyco_hydro_31_3rd702-788 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003393	`PF13802.13`	Gal_mutarotas_2	93	310	1.6e-38	133.5
LXL04_003393	`PF01055.33`	Glyco_hydro_31_2nd	367	694	4.8e-122	408.0
LXL04_003393	`PF21365.4`	Glyco_hydro_31_3rd	702	788	7.3e-27	94.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN05`	Arabidopsis thaliana	Probable glucan 1,3-alpha-glucosidase	74.218%	Swiss-Prot	strong database homology
`B9F676`	Oryza sativa subsp. japonica	Probable glucan 1,3-alpha-glucosidase	65.976%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card