LXL04_003375 | RubberDandelionOmics

Gene overview

LXL04_003375

Reference: OH-1004 Chr: Chr01 Coordinates: 76761926-76762270 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · LXL04_003375|LXL04_003375|OH1004|cDNA

ATGAAGATGGTGGCAAAAGACAAGGTGATTAAGGTCGGTATGACTGATCACATCCAGCGAGAGATTTCGGTTATGAAGATGGTGAAGCATCCTAACATTGTGGAGCTTCACGAAGTGTTAGTGAGTAGATCTAAGATCTTTTCGCTATGGAGCTCGTTAGAGGCGGCGAGTTGTTTTCTAAAGTTGAGAAAGAGCGGTTGCGAGAGGATGTTGCTCGGAGTTACTTCCAGCAGCTCATCTCCGCCGTTGGGAGAGCAGGT...

CDS

Download CDS FASTA

345 bp · LXL04_003375|LXL04_003375|OH1004|CDS

ATGAAGATGGTGGCAAAAGACAAGGTGATTAAGGTCGGTATGACTGATCACATCCAGCGAGAGATTTCGGTTATGAAGATGGTGAAGCATCCTAACATTGTGGAGCTTCACGAAGTGTTAGTGAGTAGATCTAAGATCTTTTCGCTATGGAGCTCGTTAGAGGCGGCGAGTTGTTTTCTAAAGTTGAGAAAGAGCGGTTGCGAGAGGATGTTGCTCGGAGTTACTTCCAGCAGCTCATCTCCGCCGTTGGGAGAGCAGGT...

Protein

Download Protein FASTA

114 aa · LXL04_003375|LXL04_003375|OH1004|PROTEIN

MKMVAKDKVIKVGMTDHIQREISVMKMVKHPNIVELHEVLVSRSKIFSLWSSLEAASCFLKLRKSGCERMLLGVTSSSSSPPLGEQVIRCGIDGFNFGFLHFFQQNFEFFKIFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003375`
TK1151 ID	TkA01G366930
OH-1004 ID	LXL04_003375
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003375

Location Chr01:76761926-76762270 (-)

Description Similar to CIPK11: CBL-interacting protein kinase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0824600`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os05g0332300`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os09g0418500`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os07g0678600`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os01g0536000`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003375 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0536000

dosa:Os01g0824600

dosa:Os05g0332300

dosa:Os07g0678600

dosa:Os09g0418500

osa:107275263

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · LXL04_003375 · OH-1004

Nucleus0.436

Rank 2 · LXL04_003375 · OH-1004

Mitochondrion0.109

Rank 3 · LXL04_003375 · OH-1004

Endoplasmic reticulum0.081

Rank 4 · LXL04_003375 · OH-1004

Cell membrane0.077

Rank 5 · LXL04_003375 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0JI49`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 11	46.970%	Swiss-Prot	moderate database homology
`Q5W736`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 18	48.438%	Swiss-Prot	moderate database homology
`Q6ERS0`	Oryza sativa subsp. japonica	Putative CBL-interacting protein kinase 27	45.455%	Swiss-Prot	moderate database homology
`Q7X996`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 2	45.312%	Swiss-Prot	moderate database homology
`Q5JLD8`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 8	46.970%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card