LXL04_003262 | RubberDandelionOmics

Gene overview

LXL04_003262

Reference: OH-1004 Chr: Chr01 Coordinates: 72323292-72324330 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

966 bp · LXL04_003262|LXL04_003262|OH1004|cDNA

ATGACAGCCATTGATGCTGTTACCTCGAAACTGGAGAAATCGGCTAAGATATTCGTCGCCGGCCACCGCGGCCTAGTCGGATCTGCTATCGTACGACGCCTGCGAACCGTCGGCTATACCAATCTCATTATCCGGTCACACACCGAACTAGATCTCACCAACCAGTCCGCCGTCAAAACATTCTTCTCTCTGGAAAAACCCCAATACGTGATCCTCGCAGCAGCCAAAGTCGGTGGGATCCACGCCAACAGCACCTACCC...

CDS

Download CDS FASTA

966 bp · LXL04_003262|LXL04_003262|OH1004|CDS

ATGACAGCCATTGATGCTGTTACCTCGAAACTGGAGAAATCGGCTAAGATATTCGTCGCCGGCCACCGCGGCCTAGTCGGATCTGCTATCGTACGACGCCTGCGAACCGTCGGCTATACCAATCTCATTATCCGGTCACACACCGAACTAGATCTCACCAACCAGTCCGCCGTCAAAACATTCTTCTCTCTGGAAAAACCCCAATACGTGATCCTCGCAGCAGCCAAAGTCGGTGGGATCCACGCCAACAGCACCTACCC...

Protein

Download Protein FASTA

321 aa · LXL04_003262|LXL04_003262|OH1004|PROTEIN

MTAIDAVTSKLEKSAKIFVAGHRGLVGSAIVRRLRTVGYTNLIIRSHTELDLTNQSAVKTFFSLEKPQYVILAAAKVGGIHANSTYPADFIAINLQIQTNVIDSAYRYGTKKLVFLGSSCIYPKHAPQPIPESSLLTGPLEPTNEWYAIAKIAGIKMCQAYRIQYNWDAISAMPTNLYGPNDNFHPENSHVLPALMRRFHEAKVAGSKEVVVWGTGSALREFLHVDDLADAVVFLLENYSDLGHVNVGSGKEVSIKELAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003262`
TK1151 ID	TkA01G380380
OH-1004 ID	LXL04_003262
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003262

Location Chr01:72323292-72324330 (+)

Description Similar to GER2: Putative GDP-L-fucose synthase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17890`	Catalyzes the two-step NADP-dependent conversion of GDP-4- dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.	No verified direct reference in this release
`At1g73250`	Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0652400`	Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.	No verified direct reference in this release
`Os06g0652300`	Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003262 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006005 L-fucose biosynthetic process Biological Process

GO:0042351 'de novo' GDP-L-fucose biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016853 isomerase activity Molecular Function

GO:0050577 GDP-L-fucose synthase activity Molecular Function

GO:0070401 NADP+ binding Molecular Function

KEGG gene cross-reference

ath:AT1G17890

ath:AT1G73250

dosa:Os06g0652300

dosa:Os06g0652400

rhi:NGR_a00420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.695

Rank 1 · LXL04_003262 · OH-1004

Nucleus0.270

Rank 2 · LXL04_003262 · OH-1004

Peroxisome0.123

Rank 3 · LXL04_003262 · OH-1004

Mitochondrion0.097

Rank 4 · LXL04_003262 · OH-1004

Plastid0.047

Rank 5 · LXL04_003262 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04321.24RmlD_sub_bind16-159 aa

PF01370.28Epimerase17-248 aa

PF16363.12GDP_Man_Dehyd49-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003262	`PF04321.24`	RmlD_sub_bind	16	159	2.5e-08	34.1
LXL04_003262	`PF01370.28`	Epimerase	17	248	9.7e-67	225.6
LXL04_003262	`PF16363.12`	GDP_Man_Dehyd	49	307	3.9e-21	76.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMU0`	Arabidopsis thaliana	Putative GDP-L-fucose synthase 2	78.778%	Swiss-Prot	strong database homology
`O49213`	Arabidopsis thaliana	GDP-L-fucose synthase 1	77.143%	Swiss-Prot	strong database homology
`Q67WR2`	Oryza sativa subsp. japonica	Probable GDP-L-fucose synthase 1	74.434%	Swiss-Prot	strong database homology
`Q67WR5`	Oryza sativa subsp. japonica	Putative GDP-L-fucose synthase 2	58.361%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card