LXL04_003170 | RubberDandelionOmics

Gene overview

LXL04_003170

Reference: OH-1004 Chr: Chr01 Coordinates: 70067291-70068624 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

459 bp · LXL04_003170|LXL04_003170|OH1004|cDNA

ATGCCCAAAGAAACGGAGAAAATTAAGAACCCGTTTGCTCGAAGATTAGCTTCAAGGATTGAGAGACTGCCGGTGTTTTATAAAATGCCTAGGAGAACAATGATCAAGTGTGCCTTTGCTGAAACCTGTGAAATAGTTGAATGTGTTGTTGTTTCCAAGGAAATCAGCCAAATGGTGCTTGGAATGGCGTTGATGAAGCTGTTAAGTCTCCAGCTGTTGAAGCTGAAAGTGCCCCCAACTCCATCTGAAGAAAAATGTGA...

CDS

Download CDS FASTA

459 bp · LXL04_003170|LXL04_003170|OH1004|CDS

ATGCCCAAAGAAACGGAGAAAATTAAGAACCCGTTTGCTCGAAGATTAGCTTCAAGGATTGAGAGACTGCCGGTGTTTTATAAAATGCCTAGGAGAACAATGATCAAGTGTGCCTTTGCTGAAACCTGTGAAATAGTTGAATGTGTTGTTGTTTCCAAGGAAATCAGCCAAATGGTGCTTGGAATGGCGTTGATGAAGCTGTTAAGTCTCCAGCTGTTGAAGCTGAAAGTGCCCCCAACTCCATCTGAAGAAAAATGTGA...

Protein

Download Protein FASTA

152 aa · LXL04_003170|LXL04_003170|OH1004|PROTEIN

MPKETEKIKNPFARRLASRIERLPVFYKMPRRTMIKCAFAETCEIVECVVVSKEISQMVLGMALMKLLSLQLLKLKVPPTPSEEKCDCTPAPPPAEENVTEPPPAATEETTTETLETTPGDYRFPTTNQSRHCFTRYVEYHRSVFNQFKTNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003170`
TK1151 ID	TkA06G160150
OH-1004 ID	LXL04_003170
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 36.066 / OH-1004 28.947 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003170

Location Chr01:70067291-70068624 (-)

Description Similar to COX6B-1: Cytochrome c oxidase subunit 6b-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22450`	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.	No verified direct reference in this release
`At4g28060`	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.	No verified direct reference in this release
`At5g57815`	This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003170 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:1902600 proton transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0045277 respiratory chain complex IV Cellular Component

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G22450

ath:AT4G28060

ath:AT5G57815

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.373

Rank 1 · LXL04_003170 · OH-1004

Cytoplasm0.322

Rank 2 · LXL04_003170 · OH-1004

Nucleus0.264

Rank 3 · LXL04_003170 · OH-1004

Cell membrane0.107

Rank 4 · LXL04_003170 · OH-1004

Endoplasmic reticulum0.078

Rank 5 · LXL04_003170 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7L9`	Arabidopsis thaliana	Cytochrome c oxidase subunit 6b-1	68.182%	Swiss-Prot	weak database homology
`Q9SUD3`	Arabidopsis thaliana	Cytochrome c oxidase subunit 6b-3	75.000%	Swiss-Prot	weak database homology
`Q945L0`	Arabidopsis thaliana	Cytochrome c oxidase subunit 6b-2	75.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card