LXL04_003074 | RubberDandelionOmics

Gene overview

LXL04_003074

Reference: OH-1004 Chr: Chr01 Coordinates: 66592093-66593075 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · LXL04_003074|LXL04_003074|OH1004|cDNA

ATGCATCGATTGTTTTGCAGGATGTTTTACTTCTACTTTGAATCATGCAACAACGAAAACGACCTATTTGTTATTTGGCTGACTAGGGGACTAGGTTGTAGCAGCGAGCTTGCTCTTTTCTATGAACATGGTCCTTTCAAAATCGGAGATAAACATGACTCTTGTCTGGAACGAGGGTCTAGTTATATCTTTGTTAAAAGAGACATTCGGTATGATGAACAAGGTTATGTAGATAAAGAGTTTGGAACTCGTGTTTTGAG...

CDS

Download CDS FASTA

480 bp · LXL04_003074|LXL04_003074|OH1004|CDS

ATGCATCGATTGTTTTGCAGGATGTTTTACTTCTACTTTGAATCATGCAACAACGAAAACGACCTATTTGTTATTTGGCTGACTAGGGGACTAGGTTGTAGCAGCGAGCTTGCTCTTTTCTATGAACATGGTCCTTTCAAAATCGGAGATAAACATGACTCTTGTCTGGAACGAGGGTCTAGTTATATCTTTGTTAAAAGAGACATTCGGTATGATGAACAAGGTTATGTAGATAAAGAGTTTGGAACTCGTGTTTTGAG...

Protein

Download Protein FASTA

159 aa · LXL04_003074|LXL04_003074|OH1004|PROTEIN

MHRLFCRMFYFYFESCNNENDLFVIWLTRGLGCSSELALFYEHGPFKIGDKHDSCLERGSSYIFVKRDIRYDEQGYVDKEFGTRVLRITVGHDHNDYLLARKLGIPILNVMNKYETLNEPLLSKQWFVIMAPLAEKALDIVKKDNYGAAVATGSVFGIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003074`
TK1151 ID	TkA04G235670
OH-1004 ID	LXL04_003074
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.000
Protein coverage (%)	TK1151 99.242 / OH-1004 82.390 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003074

Location Chr01:66592093-66593075 (-)

Description Similar to EMB2247: Valine--tRNA ligase, chloroplastic/mitochondrial 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16715`	Valine--tRNA ligase, chloroplastic/mitochondrial 2.	No verified direct reference in this release
`At3g45010`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g10410`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003074 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006438 valyl-tRNA aminoacylation Biological Process

GO:0006508 proteolysis Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

GO:0004185 serine-type carboxypeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G10410

ath:AT3G45010

ath:AT5G16715

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.868

Rank 1 · LXL04_003074 · OH-1004

Cytoplasm0.051

Rank 2 · LXL04_003074 · OH-1004

Mitochondrion0.024

Rank 3 · LXL04_003074 · OH-1004

Nucleus0.020

Rank 4 · LXL04_003074 · OH-1004

Endoplasmic reticulum0.016

Rank 5 · LXL04_003074 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S107-53 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003074	`PF00450.29`	Peptidase_S10	7	53	1.8e-10	41.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KE63`	Arabidopsis thaliana	Valine--tRNA ligase, chloroplastic/mitochondrial 2	46.847%	Swiss-Prot	weak database homology
`Q56WF8`	Arabidopsis thaliana	Serine carboxypeptidase-like 48	44.318%	Swiss-Prot	weak database homology
`P32826`	Arabidopsis thaliana	Serine carboxypeptidase-like 49	45.455%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card