LXL04_003043 | RubberDandelionOmics

Gene overview

LXL04_003043

Reference: OH-1004 Chr: Chr01 Coordinates: 65720166-65721044 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · LXL04_003043|LXL04_003043|OH1004|cDNA

ATGGTTCGGCCTCGGTTTGACTGTGTCGATACCTCGGTTCGGCTTCGGCTTGATTGTGTCGGTACCTCGGTTCGGCTTCGGCTTGATTGTGTCGGTACCTCGGTTCGGCTTCGGCTTGATTGTGTCGGTACCCCGGTTCGGCTTCGGCTTGATTGTGTCGGTACCTCGGTTCGGCTTCGGCTTGATTGTGTCGCAGCCAACAAGTGGCAGTTGAGTCTCGTGGCGGGTCACTTCAGTTTGGATTCATATGATACTGGAAA...

CDS

Download CDS FASTA

738 bp · LXL04_003043|LXL04_003043|OH1004|CDS

ATGGTTCGGCCTCGGTTTGACTGTGTCGATACCTCGGTTCGGCTTCGGCTTGATTGTGTCGGTACCTCGGTTCGGCTTCGGCTTGATTGTGTCGGTACCTCGGTTCGGCTTCGGCTTGATTGTGTCGGTACCCCGGTTCGGCTTCGGCTTGATTGTGTCGGTACCTCGGTTCGGCTTCGGCTTGATTGTGTCGCAGCCAACAAGTGGCAGTTGAGTCTCGTGGCGGGTCACTTCAGTTTGGATTCATATGATACTGGAAA...

Protein

Download Protein FASTA

245 aa · LXL04_003043|LXL04_003043|OH1004|PROTEIN

MVRPRFDCVDTSVRLRLDCVGTSVRLRLDCVGTSVRLRLDCVGTPVRLRLDCVGTSVRLRLDCVAANKWQLSLVAGHFSLDSYDTGKSTLIHHLATPLVFNHFLRPSHHRLPIFHPYSSCYKLKQGFYSVKSGVWSSAIARDSLSFLNRVNVKDKIEVPSPRGVGDYASEFAIGELVRFDTEVSRVSQRENGKWEVRSIQRKENEERTEEAFDAVVVGTGHYMDPRIAQIPGVLLILSNQYLHDH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003043`
TK1151 ID	TkA02G409030
OH-1004 ID	LXL04_003043
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.100
Protein coverage (%)	TK1151 81.651 / OH-1004 68.163 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003043

Location Chr01:65720166-65721044 (+)

Description Similar to At1g62620: Flavin-containing monooxygenase FMO GS-OX-like 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62620`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g63370`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g62600`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g62560`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release
`At1g62570`	Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003043 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0004499 N,N-dimethylaniline monooxygenase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

GO:0050661 NADP binding Molecular Function

GO:0080102 3-methylthiopropyl glucosinolate S-oxygenase activity Molecular Function

GO:0080103 4-methylthiopropyl glucosinolate S-oxygenase activity Molecular Function

GO:0080104 5-methylthiopropyl glucosinolate S-oxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G62560

ath:AT1G62570

ath:AT1G62600

ath:AT1G62620

ath:AT1G63370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.511

Rank 1 · LXL04_003043 · OH-1004

Nucleus0.359

Rank 2 · LXL04_003043 · OH-1004

Mitochondrion0.130

Rank 3 · LXL04_003043 · OH-1004

Peroxisome0.074

Rank 4 · LXL04_003043 · OH-1004

Endoplasmic reticulum0.069

Rank 5 · LXL04_003043 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXD5`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX-like 3	52.113%	Swiss-Prot	weak database homology
`Q9C8U0`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX-like 5	52.113%	Swiss-Prot	weak database homology
`Q94BV5`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX-like 4	47.887%	Swiss-Prot	weak database homology
`Q9SXE1`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX3	36.000%	Swiss-Prot	weak database homology
`Q93Y23`	Arabidopsis thaliana	Flavin-containing monooxygenase FMO GS-OX4	37.500%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card