LXL04_002980 | RubberDandelionOmics

Gene overview

LXL04_002980

Reference: OH-1004 Chr: Chr01 Coordinates: 64006787-64008475 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

808 bp · LXL04_002980|LXL04_002980|OH1004|cDNA

ATGCTATTTGGTCCAAGACTTCTGAAATCGAGTCTAAGACTTCTGGCAGTTACATCAGCAAACCAGTTCAAGAGTTTGGTGTCTTATACACACTGTGGTTTCGAAATCGATTTCCAGCAAACCAGTTCTAAGACTTCTGCCAGTTACATCAGCAAACCAGTTCAAGAGTTTGGTGTCTTATACACACTGTGGTTTCGAAATCGATTTCCAGATGAAATTCATATGGCTGATTTTCATTTTATTGGATTGAAGACGATTTC...

CDS

Download CDS FASTA

759 bp · LXL04_002980|LXL04_002980|OH1004|CDS

ATGCTATTTGGTCCAAGACTTCTGAAATCGAGTCTAAGACTTCTGGCAGTTACATCAGCAAACCAGTTCAAGAGTTTGGTGTCTTATACACACTGTGGTTTCGAAATCGATTTCCAGCAAACCAGTTCTAAGACTTCTGCCAGTTACATCAGCAAACCAGTTCAAGAGTTTGGTGTCTTATACACACTGTGGTTTCGAAATCGATTTCCAGATGAAATTCATATGGCTGATTTTCATTTTATTGGATTGAAGACGATTTC...

Protein

Download Protein FASTA

252 aa · LXL04_002980|LXL04_002980|OH1004|PROTEIN

MLFGPRLLKSSLRLLAVTSANQFKSLVSYTHCGFEIDFQQTSSKTSASYISKPVQEFGVLYTLWFRNRFPDEIHMADFHFIGLKTISKDYSPFLQRGGMRMVHPEELSFFDTDSGIPHHRFDAFGSRHHRHLRHRLLCSNEIYLWGGRLDHDRYRDWRLDVDTMSYKELLELGDKIGYVSTGLREDEIGCCVRKTKPPNMSDCKSSPHFPNEMQWKCTICQVSLAIEIKPFSTYTGIIYKSTYKRYSSDINL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002980`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002980

Location Chr01:64006787-64008475 (-)

Description Similar to RHG1A: Probable E3 ubiquitin-protein ligase RHG1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42940`	Probable E3 ubiquitin-protein ligase that may possess E3 ubiquitin ligase activity in vitro.	No verified direct reference in this release
`At2g15530`	E3 ubiquitin-protein ligase that functions as a regulator of MED25 stability by targeting MED25 for degradation in a RING-H2- dependent way.	Proteasome-mediated turnover of Arabidopsis MED25 is coupled to the activation of FLOWERING LOCUS T transcription.2012 · DOI: 10.1104/pp.112.205500
`At4g34040`	E3 ubiquitin-protein ligase that functions as a regulator of MED25 stability by targeting MED25 for degradation in a RING-H2- dependent way.	Proteasome-mediated turnover of Arabidopsis MED25 is coupled to the activation of FLOWERING LOCUS T transcription.2012 · DOI: 10.1104/pp.112.205500

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0648800`	Probable E3 ubiquitin-protein ligase that functions downstream of HAL3 and is required for HAL3-regulated plant growth.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002980 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009845 seed germination Biological Process

GO:0009908 flower development Biological Process

GO:0010218 response to far red light Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0061659 ubiquitin-like protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G15530

ath:AT4G34040

ath:AT5G42940

dosa:Os04g0648800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.361

Rank 1 · LXL04_002980 · OH-1004

Cytoplasm0.331

Rank 2 · LXL04_002980 · OH-1004

Mitochondrion0.267

Rank 3 · LXL04_002980 · OH-1004

Cell membrane0.061

Rank 4 · LXL04_002980 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_002980 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMM4`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase RHG1A	42.683%	Swiss-Prot	weak database homology
`Q9ZQF9`	Arabidopsis thaliana	E3 ubiquitin-protein ligase MBR1	47.887%	Swiss-Prot	weak database homology
`O49500`	Arabidopsis thaliana	E3 ubiquitin-protein ligase MBR2	71.053%	Swiss-Prot	weak database homology
`Q7XTV7`	Oryza sativa subsp. japonica	Probable E3 ubiquitin-protein ligase HIP1	51.786%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card